KEGG   Nonlabens sp. MIC269: AAT17_04780Help
Entry
AAT17_04780       CDS       T04144                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nom  Nonlabens sp. MIC269
Pathway
nom00010  Glycolysis / Gluconeogenesis
nom00053  Ascorbate and aldarate metabolism
nom00071  Fatty acid degradation
nom00280  Valine, leucine and isoleucine degradation
nom00310  Lysine degradation
nom00330  Arginine and proline metabolism
nom00340  Histidine metabolism
nom00380  Tryptophan metabolism
nom00410  beta-Alanine metabolism
nom00561  Glycerolipid metabolism
nom00620  Pyruvate metabolism
nom00625  Chloroalkane and chloroalkene degradation
nom01100  Metabolic pathways
nom01110  Biosynthesis of secondary metabolites
nom01120  Microbial metabolism in diverse environments
nom01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nom00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT17_04780
   00053 Ascorbate and aldarate metabolism
    AAT17_04780
   00620 Pyruvate metabolism
    AAT17_04780
  Lipid metabolism
   00071 Fatty acid degradation
    AAT17_04780
   00561 Glycerolipid metabolism
    AAT17_04780
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAT17_04780
   00310 Lysine degradation
    AAT17_04780
   00330 Arginine and proline metabolism
    AAT17_04780
   00340 Histidine metabolism
    AAT17_04780
   00380 Tryptophan metabolism
    AAT17_04780
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAT17_04780
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AAT17_04780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAT17_04780
Enzymes [BR:nom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AAT17_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ALM20598
UniProt: A0A0S1TCZ5
LinkDB All DBs
Position
1014085..1015548
Genome map
AA seq 487 aa AA seqDB search
MAILEGVNKQYINGQWTEGSSETNIEDKNPFNQEKLLSIKGASQEDVDKAYKTAEKAAES
WGKELPQKRAEIVNNFHDAIVDNKEELIEWLIKEAGSSRVKAEAEIQISLGIIKEAASFP
SRMHGYITNSRVPHKENRVYRRPLGVMGIISPWNFPLNLSIRSVVTAIALGNTVVLKPAS
QTPITGALAIAKLFEIAGLPKGVCNAVVGKGSDIGDYFVEHEIPKLISFTGSTPVGRNIG
KLAGQKLKRMALELGGNNVFVAMEDADVDQAVKAALYGKFMHQGQICMSINRIVVHESIA
DEFVEKFVEGTKKLKVGNPQDKEVTIGPLIDSKQVERINEDLQKSIDAGAKVVLEGKSDG
ALMHPTVLDHVTDDMPIAANEIFGPVAPIIRFKSNDEALIIANSQDFGLSGAVHTKDVEK
GLQFASKVITGMIHINDQTVNDESNVPFGGEKGSGIGRFNGDFIIEEFTRVQWISVQHEP
RDYTPFA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattagaaggcgttaacaaacaatatataaatggtcaatggacagaaggaagc
agcgaaacaaatatagaggataagaatccttttaatcaagaaaaactactttccattaaa
ggagcttctcaagaagatgtagataaagcttataaaacggcagagaaagctgcggagtca
tggggaaaagagttgcctcaaaaacgtgcagaaatagtaaataactttcatgatgctatc
gttgacaataaggaagaacttatcgagtggttaatcaaagaggcaggtagttcaagagtt
aaagcagaagcagaaatccagataagcctagggattattaaggaggctgcttcatttcct
agccgtatgcatggatatatcactaattctagagtacctcacaaagaaaacagagtttat
cgcagaccactgggcgtgatgggaattattagtccttggaactttccactcaacttatct
atacgttccgtggtgactgcaatagcgttaggaaatacagtagtattgaaaccagcatca
caaactcccattacaggagctcttgctatagccaaattatttgaaattgccggtttacct
aaaggtgtttgtaatgccgttgtaggtaaagggtcagatattggcgattactttgtagaa
cacgagattccaaaacttatctcctttacaggttctactccagtaggtagaaacatagga
aaactagccgggcaaaaattaaaacgcatggcgcttgaattaggtggtaacaatgtattt
gttgctatggaggacgctgatgtagatcaagcagtaaaggcagctttatatggtaaattc
atgcaccaaggacaaatttgtatgtcaatcaacaggattgttgtccatgaaagtatagcc
gacgagtttgtcgagaaatttgtcgaaggaactaaaaaattaaaagttggtaatcctcaa
gataaggaagttactataggtcctttgattgattcaaaacaagtggaacgtataaatgaa
gatctccaaaagagtattgatgcaggtgccaaggttgttcttgaaggtaaaagcgatggt
gctctcatgcatccaactgttctagatcacgtaacagatgatatgcctatcgctgccaat
gaaatatttggtccagtagctcctatcattagatttaagtctaatgatgaagcactaatt
atcgcaaatagtcaagactttggtttaagtggtgctgtacatacaaaggatgtcgaaaaa
ggacttcaatttgccagtaaagtgattactggtatgattcatattaatgatcaaactgtg
aatgatgaatctaatgtcccttttggaggtgaaaaaggttctggtattggaaggtttaat
ggagattttatcattgaagagttcaccagagttcaatggatatcagtacagcacgagcct
agggattatacaccttttgcataa

DBGET integrated database retrieval system