KEGG   Nonlabens sp. MIC269: AAT17_04780Help
Entry
AAT17_04780       CDS       T04144                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nom  Nonlabens sp. MIC269
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nom00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT17_04780
   00053 Ascorbate and aldarate metabolism
    AAT17_04780
   00620 Pyruvate metabolism
    AAT17_04780
  Lipid metabolism
   00071 Fatty acid degradation
    AAT17_04780
   00561 Glycerolipid metabolism
    AAT17_04780
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAT17_04780
   00310 Lysine degradation
    AAT17_04780
   00330 Arginine and proline metabolism
    AAT17_04780
   00340 Histidine metabolism
    AAT17_04780
   00380 Tryptophan metabolism
    AAT17_04780
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAT17_04780
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AAT17_04780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAT17_04780
Enzymes [BR:nom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AAT17_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1014085..1015548
Genome map
AA seq 487 aa AA seqDB search
MAILEGVNKQYINGQWTEGSSETNIEDKNPFNQEKLLSIKGASQEDVDKAYKTAEKAAES
WGKELPQKRAEIVNNFHDAIVDNKEELIEWLIKEAGSSRVKAEAEIQISLGIIKEAASFP
SRMHGYITNSRVPHKENRVYRRPLGVMGIISPWNFPLNLSIRSVVTAIALGNTVVLKPAS
QTPITGALAIAKLFEIAGLPKGVCNAVVGKGSDIGDYFVEHEIPKLISFTGSTPVGRNIG
KLAGQKLKRMALELGGNNVFVAMEDADVDQAVKAALYGKFMHQGQICMSINRIVVHESIA
DEFVEKFVEGTKKLKVGNPQDKEVTIGPLIDSKQVERINEDLQKSIDAGAKVVLEGKSDG
ALMHPTVLDHVTDDMPIAANEIFGPVAPIIRFKSNDEALIIANSQDFGLSGAVHTKDVEK
GLQFASKVITGMIHINDQTVNDESNVPFGGEKGSGIGRFNGDFIIEEFTRVQWISVQHEP
RDYTPFA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattagaaggcgttaacaaacaatatataaatggtcaatggacagaaggaagc
agcgaaacaaatatagaggataagaatccttttaatcaagaaaaactactttccattaaa
ggagcttctcaagaagatgtagataaagcttataaaacggcagagaaagctgcggagtca
tggggaaaagagttgcctcaaaaacgtgcagaaatagtaaataactttcatgatgctatc
gttgacaataaggaagaacttatcgagtggttaatcaaagaggcaggtagttcaagagtt
aaagcagaagcagaaatccagataagcctagggattattaaggaggctgcttcatttcct
agccgtatgcatggatatatcactaattctagagtacctcacaaagaaaacagagtttat
cgcagaccactgggcgtgatgggaattattagtccttggaactttccactcaacttatct
atacgttccgtggtgactgcaatagcgttaggaaatacagtagtattgaaaccagcatca
caaactcccattacaggagctcttgctatagccaaattatttgaaattgccggtttacct
aaaggtgtttgtaatgccgttgtaggtaaagggtcagatattggcgattactttgtagaa
cacgagattccaaaacttatctcctttacaggttctactccagtaggtagaaacatagga
aaactagccgggcaaaaattaaaacgcatggcgcttgaattaggtggtaacaatgtattt
gttgctatggaggacgctgatgtagatcaagcagtaaaggcagctttatatggtaaattc
atgcaccaaggacaaatttgtatgtcaatcaacaggattgttgtccatgaaagtatagcc
gacgagtttgtcgagaaatttgtcgaaggaactaaaaaattaaaagttggtaatcctcaa
gataaggaagttactataggtcctttgattgattcaaaacaagtggaacgtataaatgaa
gatctccaaaagagtattgatgcaggtgccaaggttgttcttgaaggtaaaagcgatggt
gctctcatgcatccaactgttctagatcacgtaacagatgatatgcctatcgctgccaat
gaaatatttggtccagtagctcctatcattagatttaagtctaatgatgaagcactaatt
atcgcaaatagtcaagactttggtttaagtggtgctgtacatacaaaggatgtcgaaaaa
ggacttcaatttgccagtaaagtgattactggtatgattcatattaatgatcaaactgtg
aatgatgaatctaatgtcccttttggaggtgaaaaaggttctggtattggaaggtttaat
ggagattttatcattgaagagttcaccagagttcaatggatatcagtacagcacgagcct
agggattatacaccttttgcataa

DBGET integrated database retrieval system