KEGG   Nostoc sp. NIES-3756: NOS3756_01140Help
Entry
NOS3756_01140     CDS       T04170                                 

Definition
(GenBank) Glutathione S-transferase-like protein
Organism
non  Nostoc sp. NIES-3756
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
141339..142004
Genome map
AA seq 221 aa AA seqDB search
MAEIKIYSAVTCPYAHRTRLVLQEKGIDFELNEIDLQNKPANFTDISPYGKVPALVHGDK
RVWESAIINEYLDEVFPNPPLLPKNPIDRAQARIWIDFANTRLVPAFSNLLRNPDIQKQE
EAKKELYKHLEFIENEAFGKLSLNGPYWFGESVSLVDFTFYPWFERWPALKQYRGFGIPT
EFTRIRQWKHALKELDSVKAIANPKEFYIEKYARFATPVAV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcaaaatttacagtgcagttacttgtccttatgctcatcggacaagactt
gttctgcaagagaagggtatcgactttgaactgaatgaaattgatttacagaataaacct
gccaactttactgatatttctccttatggaaaagtacctgcacttgtacatggggataaa
agagtatgggagtcagcaattattaatgagtatctagatgaggtattccccaatcctcca
ttgttaccaaaaaatcctattgatagagcgcaggctcggatttggattgattttgcaaac
actagattagttccagctttttctaatttgttgcgaaatcccgatatccaaaaacaagag
gaagccaaaaaggaactatacaaacatctggaatttatcgaaaatgaagctttcggtaaa
ttgtctttgaatggcccctattggtttggtgaatctgttagtttagttgatttcactttc
tatccttggtttgagcgctggcctgctttgaaacagtatcgtggttttggtatccctacc
gaatttacccgcatacgccaatggaagcacgcactcaaagaactggattcagtcaaggcg
atcgccaatcccaaagagttctatattgagaaatatgctagatttgctacccctgtcgct
gtctag

DBGET integrated database retrieval system