KEGG   Nostoc sp. NIES-3756: NOS3756_02330Help
Entry
NOS3756_02330     CDS       T04170                                 

Gene name
nrtB_1
Definition
(GenBank) nitrate transport permease protein NrtB
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
non  Nostoc sp. NIES-3756
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:non00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NOS3756_02330 (nrtB_1)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NOS3756_02330 (nrtB_1)
Transporters [BR:non02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    NOS3756_02330 (nrtB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
295264..296103
Genome map
AA seq 279 aa AA seqDB search
MTATLGNRVKLKKSQKALNKLFWRKIVPPLVALAIFLVLWQLLCLNPNFKLPGPIETFSE
TFDPFIIHPFFDNGESDKGLGWQILSSLGRVGLGFSLSAIAGITLGILIGVNPLVYNAVD
PIFQVLRTVPPLAWLPISLAAFQQANPSAIFVIFITSIWPILINTTVGVQQIPQDYINVA
KVLRLKGPKYFFKIVFPATVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGSFIWDAYNT
TTETNLSEIILALIYVGLVGLFLDRLVGFVASKVVADQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaactttagggaatcgtgttaagttaaaaaagtctcaaaaagctctcaataaa
ttattttggagaaaaattgtacctcctctagtagcgttagcaatttttcttgtgctttgg
caattactttgtttaaatcctaactttaaattaccagggccgatagaaacattttcagaa
acatttgacccttttatcattcatccattttttgataatggtgaaagtgataaaggttta
ggatggcaaatcctcagtagtttgggtagggtaggtttaggtttttccttatctgcgatc
gcaggcattacactaggcattttaatcggtgtcaatccattagtttacaacgctgtagat
cctattttccaagtcttacgaactgtaccgcctctagcatggctacctatttccttggca
gcatttcaacaagctaatccttccgcaatcttcgtcattttcatcacctcaatttggccg
attctcatcaacacaacagtaggtgtacaacaaattcctcaagactacattaatgtagcc
aaagttttacgtctcaaggggccaaaatacttctttaaaattgtctttcctgctactgtc
ccttatatttttacaggcttacgaatcgggattggattgtcttggttggcgattgtggcg
gcagaaatgttagttggtggtgtgggtatcggttcgtttatttgggatgcttacaacacg
actacggaaacaaatttgagtgagattattttggcgcttatttatgttggtttggttggt
ctatttctagatagattggttggttttgttgctagtaaggttgtggcggatcaaaagtag

DBGET integrated database retrieval system