KEGG   Nostoc sp. NIES-3756: NOS3756_02730Help
Entry
NOS3756_02730     CDS       T04170                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
non  Nostoc sp. NIES-3756
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:non00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOS3756_02730
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NOS3756_02730
   00680 Methane metabolism
    NOS3756_02730
Enzymes [BR:non01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NOS3756_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
338063..341140
Genome map
AA seq 1025 aa AA seqDB search
MSSVLYSLSESANFYPASELFLRHRLQIVEELWETVLRQECGQNMVDLLRQLRDLCSPEG
QATKDQAVSAVQLIEQLNINEAIRAARAFALYFQLINIIEQEFEQRQQLTRYSEIEAETA
TLDSSENITSSSNHNEDDVIFNRALGTDFLAKNWTHRGQNKQKGTFAALFPLLHKLNVPP
QQIQRLISQLDVRLVFTAHPTEIVRHTIRDKQRQVVDLLQQLDAVETRTSNGGGYPWEGA
EIREKLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRFNYALKQTF
SWLEPPSKDFCSFGSWVGSDRDGNPSVTPEITWQTACYQRKMVLERYIKSVKQLIELLSI
SMHWSDVLPDLLESLELDQSKLSEVYDALALRYRQEPYRLKLAYVLKRLENTRDRNLSLY
NGETPTNEDSPMYRNGTEFLTELRLIQHNLTETGLSCRELDNLICQVEIFDFNLTKLDIR
QESSRHSDALNEILEYLQILPQPYNELSEEERVAWLTKELQTRRPLISSELPFSDKTNDV
IKTFRVVRSLQQEFGINICQTYIISMCRQVSDVLEVLLLAKEARLFDPAIAVGTIQVVPL
FETVEDLQHSRSVMRQLFELPLYRALLAGGYAVLNGSQEIPPSPHLPLPISSTILTPDLQ
EVMLGYSDSNKDSGFLSSNWEIHKAQKSLQKIAEEYGVNLRIFHGRGGSVGRGGGPAHEA
ILAQPGHSINGRIKITEQGEVLASKYSLLDLALYNLETITTAVIQASLLRTGFDDIEPWN
EIMEELAARSRQHYRNLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLR
AIPWVFSWTQTRFLLPSWYGVGTALQQFLLEEPEEHLKLMRYFYVKWPFFKMVVSKVEMT
LAKVDMQMAGHYVQELSDPEDKPRFDKVFEQIANEYYLTRDLVLKITDHSRLLDGDPVLQ
RSVQLRNGTIVPLGFIQVSLLKRLRQSKNNTATSGVIHSRYSKGELLRGALLTINGIAAG
MRNTG
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggttttatactctttatctgagtctgctaatttctaccccgcatcggaattg
tttttgcgccatcgtctgcaaatagtagaagagttgtgggagacggtgctgcggcaagaa
tgcggtcaaaacatggtagatttattgcggcaattgcgtgatttgtgttccccagaagga
caagcgacaaaagaccaagccgtttctgctgtccagttaattgaacagttgaatattaat
gaagctatccgggcggcgagggcgtttgctttgtattttcagctcatcaacatcatagag
caagaatttgaacaaaggcagcaattgacccgctattctgagatagaagccgaaacagcc
actcttgactcttcagaaaacattacttcgtcatcaaaccataacgaagatgatgtaatt
ttcaatcgcgctttaggtacagactttctagccaaaaattggactcatcgcggacaaaac
aaacaaaaagggacattcgctgccctatttcccctgttacataagttgaatgtcccaccc
caacaaattcaacgcctcatttcccaacttgatgtccgcctagtctttaccgcccacccg
acagaaattgtccgccacaccatccgcgataagcaacgccaagtagtagatttgttgcaa
caactggatgcagtggaaactcgtacctcaaatggcggtggttatccttgggaaggggca
gaaattcgggagaaattactcgaagaaattcgcttgtggtggcggacagatgaactccac
caattcaagccgactgtgttggatgaagtagattatgctttgcactacttccaagaagtt
ttatttgatggcattccccaactgtataaacgctttaattatgcgttgaagcaaacattc
tcttggttagaaccaccaagcaaagatttctgttcctttggttcctgggtaggttctgac
agagatggaaacccatcggtaacgccggaaattacttggcagactgcttgctatcagcga
aaaatggtgttggagagatatatcaagtctgtcaagcaattgattgaattgttaagtatc
tccatgcactggagtgatgtgttaccagacttactggaatctctggagttagaccagtcc
aagttaagtgaagtatacgacgcattggcgctgagatatcgccaagaaccctatcgcctc
aaactagcttacgtcttgaagcggctggaaaatacccgcgatcgcaatttatccttatat
aatggcgaaacccccaccaacgaagatagccccatgtaccgcaacggtacagaatttttg
acagaattacggctaattcagcataacctgacggaaacgggtttaagttgtcgagaattg
gataatctcatctgtcaagtcgagatatttgactttaacctaacgaaattagatattcgc
caagaatcatccagacactcagacgctttaaacgaaattctggaatacctgcaaatatta
ccccaaccatacaacgaactatccgaagaagaacgagttgcttggctaaccaaagaactg
caaacccgccgccccttaatttcctcagagttaccattctccgacaaaactaatgatgtc
attaaaacattccgcgtagtgcgatcgctacaacaagaatttggcattaatatctgccaa
acctacatcattagtatgtgtcgtcaggttagtgatgtcttagaagtgctgctactcgcc
aaagaagccagactttttgaccctgcgatcgccgtcgggacaattcaggttgtaccatta
tttgagactgtcgaagacttgcaacattcgcgtagcgtcatgcgccagttattcgagtta
cccttataccgcgccttactagcaggaggttatgcagtccttaacggtagccaagaaatt
cccccatcgcctcatctccctctccccatatcctcaactatcctcacccccgatttacaa
gaagtgatgctggggtattctgacagtaacaaagactccggcttcttaagtagcaactgg
gaaattcacaaagcccaaaaatccttacaaaaaattgctgaagaatatggcgtgaatttg
cgaattttccacggacggggcggttctgtgggtagaggtggtggcccagcccacgaagcg
attttggcgcaaccaggacacagcatcaacgggcggattaagattaccgaacaaggggaa
gtattagcttctaaatattccctgctagatttagctttgtacaacttagaaaccatcacc
acggcggtaattcaagccagcctgttgcgcacagggtttgatgatatcgaaccttggaac
gaaatcatggaagaattagccgcgcgatcgcgtcaacattatcgtaatttaatttacgaa
caacctgatttcatcgacttctttcatcaagttacccccatcgaagaaattagccaactg
caaattagttcccgtcccgcccgccgtccttctggaaagaaagacttaagcagcctccgc
gccattccttgggtatttagctggacacaaacccgcttcttattaccttcctggtacggt
gtcggtacagctttgcaacagtttctcttggaagaaccagaggaacatctaaaattgatg
cgttacttttacgtcaagtggcctttcttcaagatggtagtttccaaagtagaaatgacc
ttggcaaaagtagatatgcaaatggctggtcattacgtacaggaattatccgaccctgaa
gataaacccaggtttgataaagtatttgagcaaattgccaatgagtattatctcaccaga
gatttagttctcaaaatcaccgaccacagccgcctcttagatggcgatcctgtactccag
cgttctgtacagttacgcaacggtacaatcgttccgttaggttttattcaagtatccctc
ctaaaacgcctccgccagtccaagaacaatactgcaacctctggtgtcatccactcccgt
tacagcaaaggcgagttactacgcggcgcactgttaaccattaatggtatcgctgcgggg
atgagaaatacaggttga

DBGET integrated database retrieval system