KEGG   Nostoc sp. NIES-3756: NOS3756_17120Help
Entry
NOS3756_17120     CDS       T04170                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00630  Glyoxylate and dicarboxylate metabolism
non00710  Carbon fixation in photosynthetic organisms
non01100  Metabolic pathways
non01120  Microbial metabolism in diverse environments
non01200  Carbon metabolism
Module
non_M00165  Reductive pentose phosphate cycle (Calvin cycle)
non_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
non_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:non00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NOS3756_17120 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NOS3756_17120 (rbcS)
Enzymes [BR:non01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NOS3756_17120 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Guanylate_cyc_2
Motif
Other DBs
NCBI-ProteinID: BAT52771
UniProt: A0A0S3PAL9
LinkDB All DBs
Position
1955797..1956126
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDVQIEKQVQYILNQGYFPAIEFNEQSEPTEYYWTLWKLPL
FNAKSTREVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagagcgtcgttacgaaaccctttcttacttacctcccctcacc
gatgttcaaattgaaaagcaagttcagtacattctgaaccaaggctactttccagccatt
gagttcaacgaacaatctgaacctaccgaatattactggacactgtggaagctacccctg
ttcaacgctaaaagcacccgcgaagtattggcagaagttcaatcttgtcgttctcaatat
cctggccactacatccgtgtagtaggatttgacaacatcaaacagtgccaaatcctcagc
ttcatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system