KEGG   Nostoc sp. NIES-3756: NOS3756_40740Help
Entry
NOS3756_40740     CDS       T04170                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
non  Nostoc sp. NIES-3756
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:non00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NOS3756_40740
Enzymes [BR:non01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NOS3756_40740
Transporters [BR:non02000]
 Other Transporters
  Pores ion channels [TC:1]
   NOS3756_40740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4758059..4758715)
Genome map
AA seq 218 aa AA seqDB search
MLKFYYNPISINARRVWVALLEKQIPFEPLLLNLDGDQFQDQFTAINPLQRVPVIVDDGL
RVVESLAILDYLEAKYPTPSLIPSEATAIATVRMVETTTVTELQPATVILTRPLVELDTD
PKKLESAQEAVTKILSFYETLLGDQTYFAGEKFTLAEVVAGTLIPSLPLFGFSLDDYPRL
LAWAERLEQRESWQKTTPNFAALAAAIPNIKAILERRF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagttttactacaatcctatatctattaacgcccgtcgagtttgggtagcttta
ctagaaaaacaaattccttttgaaccattgttattaaatcttgatggtgatcagtttcaa
gatcagttcactgctattaaccccctccagcgtgtaccagtgatagtagacgatggctta
cgtgtggtcgaatcattagcaattttggattatctggaagcgaaatatcctaccccatca
ctaattcctagcgaagcaactgcgatcgccaccgttcgcatggtagaaactacgacagta
accgagcttcaacctgctactgttatcttaactagaccgttagtagaattagacactgat
cccaaaaagctagaatcagcccaagaagctgtaacaaaaattttaagcttttatgaaaca
cttttaggagaccagacttattttgcaggcgaaaaatttaccctagcagaagtagttgct
ggtacattgattccgtccctacctctatttggcttctctttagatgattatccacgtttg
ttagcctgggcagaaagattagagcaaagagaaagctggcaaaaaacgacaccaaatttc
gctgctcttgcagctgctatccccaacattaaagcaatcctagaacgaagattttaa

DBGET integrated database retrieval system