KEGG   Natronococcus occultus: Natoc_3153Help
Entry
Natoc_3153        CDS       T02426                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K19588  
2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
nou  Natronococcus occultus
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Natoc_3153
   00053 Ascorbate and aldarate metabolism
    Natoc_3153
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Natoc_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3071472..3072920
Genome map
AA seq 482 aa AA seqDB search
MSDSKQNYIDGEWRDASTGETIETTNPAAPSESVARYQQSNAEDAEEAVAAAASARDDWA
ATPGPKRGAILREAASILKDRKEELTELLTREEGKTHAEAGGEVQRAVDIFYYFAEKTRD
LGGTVKAASGSQTNLYTVNQPVGVAALITPWNYPIAIPAWKIAPALAAGNTLVLKPATVA
AGTAVAIFEALDEAGLPDGVANIVTGPGSTVGETLVSHDDVDAVSFTGSSEVGEMVYSKA
TDDGKRVQTELGGKNPTVVSDSVDVDEAAEIVANGAFGVTGQACTACSRAIVHADVRDEF
VDRVVEHADAIEIGPGDEYDMGPQVTESELEGTLEYIDIAADEGATLETGGGRPEGERFE
EGYYVEPTVFTDVEPDYRIAQEEVFGPVLAVIEVEDFETGLRVANDVDYGLAASIITENH
TEAERFVDEIEAGVAKVNDGTTGLELHVPFGGFKRSSSETWREQGDAGLDFYTIEKTVYD
SF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacagtaagcaaaactacatcgacggagagtggagagatgcgtcaaccggtgaa
accatcgaaacgaccaaccctgcagccccctcggaatccgttgctcgctatcagcagtcg
aacgccgaggacgcggaggaggcggtcgctgcagcagcgagcgctcgcgatgactgggcg
gcgacccccggaccgaagcgcggcgcgatcctgcgcgaggcggcgtcgattctcaaggac
cgcaaggaggagttgaccgaactcctcacgcgcgaggaaggcaagacccacgccgaagcc
ggcggcgaagtacagcgggccgtcgatatcttctactacttcgctgaaaagacgcgagat
ctcggcgggaccgtcaaggccgccagcgggtcgcagacgaacctctacacggtgaaccag
cctgtcggcgtcgccgcgctgatcacgccgtggaactatccgatcgcgatccccgcctgg
aagatcgcccccgcactcgccgcggggaacacgctcgtgctcaaaccggcgacggtcgcg
gccggcaccgcagtcgcgatcttcgaggcactcgacgaggcggggctccccgacggcgtc
gcgaatatcgttacgggtccggggagcacggtcggcgaaacgctcgtctcccacgatgat
gtcgacgccgtctctttcaccggtagtagcgaagtcggcgagatggtgtactcgaaggcc
accgacgacgggaaacgcgttcagacggagctcggcgggaagaacccgaccgtcgtttcc
gatagcgttgacgtcgacgaggccgccgaaatcgtcgctaacggcgctttcggcgttacc
ggtcaggcctgtaccgcctgttcgcgcgcgatcgtccatgcggacgttcgcgacgagttc
gtcgatcgggtcgtcgaacacgccgacgcgatcgagatcggtcccggtgacgagtacgat
atgggaccgcaggtcaccgaaagcgagctcgaggggaccctcgagtacatcgatatcgca
gccgacgagggcgccactctcgaaacgggcggcggccgtcccgaaggggagcgcttcgag
gaggggtactacgtcgagccgaccgtctttaccgacgtcgaacccgattaccgtatcgcc
caggaggaggtcttcggtcccgtcctcgccgtaatcgaggtcgaggacttcgagacaggg
cttcgagttgctaacgacgtcgattacggccttgcagctagtatcatcacggagaaccac
acggaggctgaacggttcgtcgacgaaatcgaagcgggcgtcgcgaaggtaaacgacgga
acaaccggtctcgagctccacgttcccttcggcgggttcaagcgctcctcgagcgaaacg
tggcgcgagcagggcgatgcggggctcgatttctacacgatcgagaagaccgtctacgat
agcttctga

DBGET integrated database retrieval system