KEGG   Neofusicoccum parvum: UCRNP2_2349Help
Entry
UCRNP2_2349       CDS       T03126                                 

Definition
(RefSeq) putative animal heme peroxidase family protein
Organism
npa  Neofusicoccum parvum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 953 aa AA seqDB search
MCPLLLSLNRTLCLTESVRTYKDGRLKPDAFSGVRILGQPPGVCALLVAFNRYHNWVVEE
LAANNEDDRFPSVESLKLKFKDQQYREKVVKRDEDLFQTGRLITCGLYVNIILGDYLRTI
LNLNSNPVNSNWTLDPRKAFEGEHIFDQKGIPMGMGNQVSAEFNFVYRWHCAVSNRDQKW
MEEFIPKKIMEGRIQHWSEASPDELRRSMIYWAIKQKEQDPEDRTFEDAEGKDIPRQENK
QFPDDPLIELLCEGTDNVAGAYGARNVPAALKFVENLGIKQGREWGLATFNEFRRFFNLK
EFKSFKEINSQPGVAEALETLYGHPDNVELYVGLMVEEAKQPFSPGSGLCPGFTISEAIL
ADAVALVRGDRFYSIEWGPQSLTKWGFAEITVDDNVAGGGALYKLLMRAFPQWYTPNSVY
ALYPFSTPERTRELVQTGALRNVELNYNRPKRAPLPKAICSWKAVHDVLCDQQRFKVPWG
EHTWQMIGRDYMLSGDTAANAKQRVAVNRAMYEPADTLDRVRSFYEAITGKLIYDNRRRL
DQGFQIDIVKDIGNLAHATFTAKYFGIPLSGPVWDWESGHWKYSGAEKLYNKLARLFEYV
FLDLDPTKSYKHRVTASAEAQKLAHELRRSLHSIRSPGWFGPLKHILDHLDPLNSFGKGL
AARLLGSGKDVEQVVWEVIPTAAAASATQAQAWGQMIEVYFRDENKHHWHEILRLAKSDS
HESFELLRKYVLEGFRLSPAASGVIRVAATAATIPDGQENGQAREVTVGPGEPLFLSFIE
AGLDPEKFPNPQEINPNRPEENYIHHGWGPHSCLGQKIVPVAAAAMLRVFARECSDPQRT
PGPAGKMKRRDFKVALPAIGADKRENWKGFPQFMAEDGSEWKNFPTSMKLIYGQPIKATL
KHNIVVKNPEGDVIGHVKGHIKGHVHDPMNGGPVGHVNGFVNGQVDGFQMPLK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccactgttgctctccctgaaccggaccttgtgtttgacagagagtgtgcgaaca
tacaaagatggacgcttaaagccggacgccttttctggtgtgaggatccttggccagcct
cctggtgtctgcgcactcctggttgccttcaatcggtaccacaactgggttgttgaggaa
ttggctgccaacaacgaagacgatcgtttccccagcgttgagtctctgaagctcaaattc
aaagatcaacaataccgtgagaaggtggtgaagcgtgatgaggaccttttccaaactggt
agactcatcacttgcggtctctacgtcaacatcattcttggagactatctccggactatt
ctcaatctgaatagcaatcctgtcaattcaaactggacgcttgaccctcgaaaggccttc
gaaggcgagcacatcttcgatcagaaaggcatacctatgggcatgggaaaccaggtcagc
gctgagttcaactttgtctaccggtggcactgcgcagttagcaacagggaccaaaaatgg
atggaagaattcatccccaagaagatcatggaaggaaggattcagcattggagtgaagca
agtccggacgagcttcgtcgcagcatgatatactgggctatcaagcaaaaagagcaagat
ccagaggaccggacttttgaggacgcagaaggaaaagatatcccgagacaggagaacaag
cagttcccagacgatccgttgattgagttgctttgtgaggggactgataacgtagcaggt
gcttatggggcccggaacgtcccagcagccttgaaattcgtcgagaatctgggaatcaag
cagggacgggaatggggtctagccaccttcaacgagttcagaagatttttcaatctgaag
gagttcaagtccttcaaggagataaacagccagccaggcgtagccgaggctctggaaaca
ttatacggccacccggacaacgtggagttatacgtggggctgatggtagaggaagcaaag
caaccgttctctcccggatcaggtctttgtccaggatttaccatttccgaggccatcctt
gccgacgccgttgctctggtccgcggcgaccgcttctactcaattgagtggggaccgcaa
agcctgaccaagtggggcttcgctgaaatcacggttgatgacaacgttgctggtggcggc
gccttgtacaagcttcttatgcgggccttccctcaatggtacacccctaatagcgtctac
gcgctgtacccattcagcaccccggagaggacgagggagctggtccagactggcgccctg
agaaacgttgagctgaactataaccggccaaagcgcgccccgctgccgaaagcgatctgt
tcgtggaaagctgtccacgatgtgctctgcgatcagcagcggttcaaagttccttggggc
gagcacacatggcagatgatcgggcgtgactacatgctcagtggagataccgccgccaat
gccaaacagcgggtcgcagtgaatcgcgccatgtacgagcctgcagatacattggaccgg
gtccgcagcttctacgaagctatcaccgggaagttgatctacgacaaccggcgcagactc
gatcaaggcttccagatcgacatcgtcaaagacatcgggaacctggcccacgccacattc
acagccaagtattttggcatcccgctcagtggtcccgtatgggattgggaaagcggccac
tggaagtactctggtgccgaaaaactgtacaacaagctcgctcgtctcttcgagtacgtg
ttcctcgacctggaccctaccaaatcgtacaagcaccgcgtcacggcgtcagcggaagca
cagaaactagcccacgagcttcgcagatccctccattccatcagatcaccgggctggttt
ggtcctctgaagcatatcctggaccacctagaccctctcaacagcttcggaaaaggcttg
gcagccaggctgcttgggagcgggaaggacgtggagcaggtggtgtgggaggtcattccc
actgcagctgccgcttccgcaacacaggctcaagcgtggggtcaaatgatcgaggtatac
ttcagggacgagaacaagcaccactggcatgaaattttgaggctcgccaagtcggactcg
catgaatcatttgaactgctcaggaaatacgtcttggaaggcttccgcctctcccctgcc
gcttccggggtcattcgcgttgccgccaccgccgccaccatcccagatggtcaagagaac
ggccaagcccgagaggtcaccgtcggtcctggcgagccgcttttcctcagcttcatcgag
gccggcctcgatccggagaaattccccaacccccaggagatcaacccgaaccggcccgag
gaaaactacatccaccacggctggggaccgcattcctgcctgggccagaagattgtgcct
gttgcggcggcagcaatgctgcgtgtcttcgcacgtgagtgctcggatccgcagaggact
cctggacctgccggcaagatgaaacggagggacttcaaagtcgcacttccagcaattggc
gccgacaaacgggaaaattggaagggattcccgcaattcatggctgaagatggcagcgag
tggaagaatttccctacctcgatgaaattgatctatggtcagccgataaaggcaactctc
aagcacaatattgtggtgaaaaaccccgaaggagacgtcattggacatgtcaagggacac
atcaagggacacgtgcacgaccctatgaacggaggtccagttgggcatgtgaatggattt
gtcaacggacaggtggacggattccagatgcctctcaagtaa

DBGET integrated database retrieval system