KEGG   Neofusicoccum parvum: UCRNP2_3762Help
Entry
UCRNP2_3762       CDS       T03126                                 

Definition
(RefSeq) putative superoxide dismutase protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
npa  Neofusicoccum parvum
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:npa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    UCRNP2_3762
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCRNP2_3762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVIRGDSNVKGTVTFEQESESAPTTISWNLSGHDANAERGMHIHAFGDNTNGCTS
AGPHFNPHSKGHGAPTDEDRHVGDLGNIKTDGQGNSTGSVTDKLVKLIGAESVIGRTVVC
HAGTDDLGKGGNEESKKTGNAGPRPACGVIGISA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgcagttatccgtggtgactccaacgtcaagggcaccgtcaccttc
gagcaggagtccgagtccgcccccaccaccatctcatggaacctcagcggccacgatgcc
aacgctgagcgtggcatgcacatccacgccttcggcgacaacaccaacggctgcacttcc
gccggccctcatttcaacccccacagcaagggccacggtgctcccaccgacgaggaccgt
cacgtcggtgaccttggcaacatcaagaccgacggccagggcaactcgactggctccgtc
actgacaagctggtcaagctgatcggtgccgagagcgtcatcggccgtaccgtcgtctgc
cacgccggcactgacgacctcggcaagggcggcaacgaggagtccaagaagactggcaat
gctggtccccgtcctgcctgcggcgtcattggtatctccgcttaa

DBGET integrated database retrieval system