KEGG   Neofusicoccum parvum: UCRNP2_7319Help
Entry
UCRNP2_7319       CDS       T03126                                 

Definition
(RefSeq) putative mitogen-activated protein kinase protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
npa  Neofusicoccum parvum
Pathway
npa04011  MAPK signaling pathway - yeast
npa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:npa00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UCRNP2_7319
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    UCRNP2_7319
Enzymes [BR:npa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     UCRNP2_7319
Protein kinases [BR:npa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   UCRNP2_7319
Chromosome and associated proteins [BR:npa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     UCRNP2_7319
Exosome [BR:npa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UCRNP2_7319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 19026903
NCBI-ProteinID: XP_007586575
UniProt: R1G3H6
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MSRAQPQGSSRKISFNVSEQYDIQDVVGEGAYGVVCSALHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRNYETFTEVYLIQELMETDMHRVIRTQELSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTEDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDIWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKIPWKAMFPKSSDLALDLLERLLAFNPVKRITV
EEALKHPYLEPYHDPDDEPTADPIPEEFFDFDKNKDNLTKEQLKMLIYQEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcacagccccagggcagctcgaggaagatatccttcaacgtttcggagcag
tacgatatccaagatgtggttggtgagggagcctatggagttgtctgctccgcgctgcac
aagccctccggccagaaggtcgcgatcaagaagattacgcccttcgaccattccatgttc
tgtctgcgcacgctccgtgagatgaagcttttgcggtatttcaatcacgagaacatcatt
tcgattctcgacatccagaagccgaggaattacgagaccttcaccgaggtctacctcatc
caggagctcatggagaccgatatgcaccgcgtcatcagaactcaagaactctccgacgac
cactgccagtacttcatttaccagactctgcgtgccttgaaggccatgcactccgcaaac
gttctccaccgcgatctcaagccctctaacctgctcctgaacgcaaactgcgatcttaag
gtctgcgacttcggtctcgcccgctctgccgcgtcgaccgaagacaactctggtttcatg
acggaatacgtggcaactcgctggtaccgtgcgccggagatcatgcttacgttcaaggag
tacacgaaggcgattgatatttggagtgttggctgcattttggcagaaatgttgagtgga
aagcctcttttccctggcaaggactaccaccaccagctcaccttgatccttgatgtgttg
ggcacgcccacgatggaggactactacggcatcaagtcgcgtcgcgctcgcgagtacatc
cgttccttgcccttcaagaagaagattccctggaaggccatgttcccgaagagctctgat
cttgccctcgacctgctcgagcgcctacttgctttcaaccccgtcaagcgtatcactgtc
gaggaagctctgaagcacccgtacctcgagccgtaccacgatcccgacgacgagccgacg
gccgacccgattcctgaggagttcttcgatttcgacaagaacaaggacaacctgaccaag
gagcagcttaagatgctcatctaccaggagattatgcggtaa

DBGET integrated database retrieval system