KEGG   Neofusicoccum parvum: UCRNP2_7556Help
Entry
UCRNP2_7556       CDS       T03126                                 

Definition
(RefSeq) putative fatty acid oxygenase protein
Organism
npa  Neofusicoccum parvum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1116 aa AA seqDB search
MSLHFSSEPELSQLDKTRREVSDAVSKISTLISQAVKPLPTGTGNGADLSAEDYHTDAFE
AAEAGLSDLSHMGITDYKTLYNVLQQKLTGELVDDKTYFMERLIQAAAKLPDTSPTGNKL
TEGFLTQLYNDLQHPPQSYLGGHLKYRQADGSWNSLKHPKLGAAGMPYARTVQPKAPQLV
ALPDAGVVFDSVMARKKSEKHPNQISSMLFYLASIIIHDLFRTDHDDFSRSKTSSYLDLA
PLYGSNDDELKTMRSGKNDGKLKPDCFAETRLLLFPPGVGVLLIMFNRFHNYVAGQLADI
NEGNRFSKPVEGRTGPHAKTWEQYDEDLFQTARLITCGLYINCILLDYVRSILNLNKTDS
NWALNPRAEIKGLEQGVGNQVSAEFNLVYRWHSVISDRDEKWTEDLWKELFPDKDPKKME
MHEFLARLSKLDDLTPKEPEKRVFNKMKRKADGTFDDDELVKVLVESVEDCANSFGAQRV
PAVMRAIEVLGIEQARAWNCATLNEFRKYFNLTPHTSFEDINPDVADQLKHLYETPDMVE
LYPGLVVESAKEPMVPGSGLCTNYTISRGVLSDAVALVRGDRFYTLDYHPKTLTNWGYAL
IDSDKTIDNGCVFYKLFMRAFPNHFEPNSVYAHYPLTVPSEMKNVLETLGKAHMYNFDKP
KHTKHPQLIYSYECAEKILGDKDTFHVTWGPAMEFLMGKPAKSFMLAGDGYENQESRKMM
SEALYVKEWQKEVKTYYLAKSKEILKKKSYTLGDSLNQVDLVRDVGNLVHVHFAADLFLL
PLKTEKNPHGMFTEHELYMILAAVFTVVFFDLDPASSFPLRQKGFKATQALGKLVELKVK
EIHAGGGILSHAMSLVFPSASTGNSLEHYGIHLIERLLKSGIDTHDLVWGHIMGTAGGMA
PNQGQLFAQTMEFFLTTEQGRTLLPTCRALALRDDDESFDKLMHYFMEGSRLYGETGVFR
YATKPVTVVDSGRTLELQPGDQLMVHLRAVSRDPKIFPNPDDVDITRPLDAYIHLGAGQH
QCLGLPMTRIALTTLFKVVLTECPGLRVAKGPQGTIRKVEQVSGPPELERAEVRYHKYLT
EMNDSFFPFPQSLKVNWDNAEVQESSNANGSANGST
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcatttctcgtccgagcccgagctctcgcagctcgacaagacccgcagagag
gtctccgatgctgtctccaagatcagcaccctcatcagccaggccgtgaagccgctgccc
accggcaccggaaacggcgccgacctgagcgccgaggactaccacacagatgcctttgag
gccgcggaagctgggctttccgacctgagccacatgggcatcaccgactacaagaccctg
tacaacgtgctccagcagaagctcaccggcgagctcgtcgacgacaagacctatttcatg
gagcgcttgatccaagctgccgcaaagctgcccgacacttctcccaccggaaacaagctg
accgagggcttcctcacccagctctacaacgacctgcagcatccgccgcaatcctacctc
ggaggccacctcaagtaccgccaggccgatggctcctggaacagcctgaagcacccgaag
cttggcgctgccggcatgccctacgcaaggacggtgcagcccaaggctccccagctggtg
gctctgcccgatgccggcgtcgtcttcgacagtgtcatggcccggaagaagagcgagaag
caccccaaccagatatccagcatgctcttctacctggcctccatcatcatccacgacctc
ttccgcaccgaccacgatgacttcagcaggtcaaaaacctcgtcataccttgacctcgcc
cctttgtacggcagcaacgacgacgagctgaagaccatgaggtctggcaagaacgacggc
aagctcaagcctgactgcttcgccgagacgcgcctccttttgttccctccgggcgtgggt
gtgctgctcatcatgttcaaccgcttccacaactacgtggcgggccaactagccgacatc
aacgagggcaacagattttccaagccggtcgagggcaggacaggcccgcatgccaagacg
tgggaacagtacgacgaggacctgttccagacggcacgtctgattacttgcggtctctac
atcaactgcattctcctcgactatgtccggtccattctcaacctcaacaagacggacagc
aactgggcgcttaaccctcgtgccgagatcaagggcctcgagcagggcgttggcaaccag
gtctcggctgaattcaatctggtgtaccgctggcactcggtcatctcggaccgcgacgag
aagtggaccgaggatctctggaaggagcttttccctgacaaggacccgaagaagatggag
atgcacgagttcttggcgcgcctcagcaagctggatgacctaaccccgaaggagcccgag
aagagggtgttcaacaaaatgaagcgcaaggccgacggtacgtttgacgacgacgagctc
gtcaaggtgctcgtcgagagcgttgaagactgcgccaacagcttcggcgcccagcgtgtg
cctgctgtgatgcgtgccatcgaggtcctcggcatcgagcaggctcgcgcctggaattgc
gcgaccctgaacgagttcaggaagtatttcaacctgacgccgcatacgtccttcgaagac
atcaaccccgatgtggctgatcagctgaaacacctctacgagactcccgacatggtcgag
ctgtatcccggtcttgtcgtggagtcggcaaaggagcctatggtccctggctccggactc
tgcaccaactacaccatctcccgcggcgtgctctccgacgctgtggctcttgtccgcggc
gaccgcttctacactttggactatcatccaaagacgttgacgaactggggctacgctctg
atcgattccgacaagacgattgacaacggctgcgtcttctacaagcttttcatgcgtgca
ttccccaaccactttgagcccaactccgtctacgcacactaccctctcacggttccgtca
gagatgaagaatgtgcttgagacgctgggcaaggcacacatgtacaacttcgacaagccc
aagcacaccaagcatccccagctcatatactcgtacgagtgcgctgagaagatcctcggc
gacaaggacacgttccatgtgacttgggggccggccatggagtttctcatgggcaagccc
gccaagagcttcatgcttgctggcgacggctacgagaaccaggagtcgcggaagatgatg
tctgaggctctgtacgttaaggagtggcagaaggaggtcaagacctactacctcgcaaag
agcaaggagattttgaagaagaagtcgtacacgctgggcgacagtctcaatcaagtcgac
ctcgtccgcgacgtcggcaatctggtgcatgtccacttcgccgccgacctcttcctcctg
ccgctcaagaccgaaaagaacccgcacggcatgttcaccgaacacgaactgtacatgatc
cttgcggccgtcttcaccgtcgttttcttcgacctggacccagcctcctcgttccctctc
cggcagaagggcttcaaggccacgcaggctctgggcaagttggttgagctgaaggtcaag
gagatccacgctggcggtgggatcctgtcgcacgccatgtctctcgtgttcccttcggcc
agcaccggcaacagccttgagcactacggtatccacctcatcgagcgcctcctcaagtct
ggcatcgacacgcacgatctcgtgtggggccacatcatgggcacggcgggtggcatggcg
cccaaccagggccagctcttcgcgcagacgatggagttcttcctgacgacggagcagggc
cggacactgctgccgacgtgtcgggcattggcactgcgcgacgatgacgagagcttcgac
aagctgatgcactacttcatggaaggcagccggctgtacggtgagacgggcgtgttccgc
tacgctaccaaaccagtcacggtagtcgacagcggccgcactctcgagctgcagcctggc
gaccagctgatggtgcacctgcgcgccgtctctcgagaccccaaaatcttccccaacccg
gacgatgtcgatatcacccgcccgctcgacgcgtacatccacctcggcgccggccagcac
cagtgcctgggcctgccgatgacgcgcatcgccctgaccacgctgttcaaggttgtgctg
acggagtgccccggcctgcgcgtcgccaagggcccacaggggactatcaggaaggtcgag
caggtttcgggcccgccggagctggagagggcggaggtcaggtatcataagtacttgacg
gagatgaacgactcgttcttcccgttcccgcagtccctgaaagtcaactgggacaacgcg
gaggtgcaggagagcagcaacgcgaatggaagtgcgaatggaagcacatga

DBGET integrated database retrieval system