KEGG   Neofusicoccum parvum: UCRNP2_891Help
Entry
UCRNP2_891        CDS       T03126                                 

Definition
(RefSeq) putative glutamate decarboxylase protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
npa  Neofusicoccum parvum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UCRNP2_891
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_891
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCRNP2_891
   00430 Taurine and hypotaurine metabolism
    UCRNP2_891
Enzymes [BR:npa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCRNP2_891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MLASHVDPDELIQKFHDHPVHTRGFHSSNAVNHNTPYSSRYASTTELSKFKIPHDGAPAD
AVHQMLKDELDLDGRPNLNLASFVGTYMEEQAEKLMIENLSKNMSDADEYPAMMQMHARC
VSILAHLWGVQKGEKAVGTATTGSSEAIHLGGLAMKRRWQEKRRADNKPTDKPNIIMGSN
AQVALEKFARYFEVEARILPVSAKSRYRLDPDLVRENIDENTIGVFVILGSTYTGHYEPV
EEISKILDDYEAKTGVDIPIHVDGASGAFIAPFTHAGVGGPKWNFELPRVKSINVSGHKF
GLVYAGVGWIIWRDEAYLPKHLIFELHYLGGTEESYTLNFSRPGAQIIAQYYNLIHLGFT
GYRTIMENALSNARLLSRALEATGWYECVSDIHRKKGDFKYEEGKKPFDEGEDSAAYNSG
LPVVAFTLSKKFKEQYPHVRQVSVSNLLRAKQYIIPNYPLPPNEEKTEILRVVVRESMSL
DLLDRLITDICAVTESVMQSDQIDLSAWQPSNSSVEKTHGSRGLDGKDKHKAKRPMHHGV
HRAVC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaagccacgttgacccggatgagctcatccagaagttccacgaccaccccgtc
cacacccgcggcttccattccagcaacgccgtgaaccacaacaccccctactcgagccgt
tatgcctcgaccaccgagctctccaagttcaagattccgcacgatggagcccctgccgac
gctgtgcaccaaatgctgaaggacgagctcgatcttgacggccgtcccaatctgaacctt
gcctccttcgttggaacatacatggaggagcaggccgagaagctcatgatcgagaacctg
tccaagaacatgtcagacgcagacgaatatcccgcaatgatgcagatgcatgctcgctgc
gtgtcaattcttgcgcacctttggggtgtccagaaaggagagaaagccgtgggcacagct
acgaccggctcaagcgaggccattcatctcggtggtctcgccatgaagcggcgttggcaa
gagaagcggagggccgacaacaagcccacggacaagcccaacatcatcatgggatccaat
gcacaggtggcattggagaagtttgcccggtacttcgaagtcgaggcccgcatcctgccg
gtcagtgcgaagagtcggtaccgtctggacccggatctcgtgcgggagaacattgatgag
aacaccatcggtgtattcgtcattcttggatcaacctacaccggccactacgaaccagtg
gaggagatttccaagatcttggatgattacgaagccaagactggagttgacattcccatc
cacgtcgacggcgcctctggtgcatttatcgcgcctttcacgcacgccggtgtgggtggg
cccaagtggaactttgagcttccccgggtgaaatccatcaacgtttccggccacaagttt
ggtctcgtctatgccggtgttggatggatcatctggcgggacgaggcctaccttcccaag
catctcatcttcgagcttcactaccttggcggcacagaggaatcatacaccctgaatttc
tcacggccaggtgctcagatcattgcgcagtactacaacctgattcacctcggcttcacg
ggctaccgcaccattatggagaacgccttgtcaaatgctcgactgctgagtcgagctctc
gaagctaccgggtggtacgaatgcgttagcgatatccaccggaagaagggagatttcaag
tatgaggaaggaaagaagccctttgacgagggtgaagacagtgctgcctacaactctggg
ctgccagttgttgcgttcaccttgagcaagaagttcaaggaacagtatccgcatgtcagg
caggtctccgtcagcaacctgttgagagcgaagcaatacatcatcccgaactatcccctt
ccgccaaatgaggagaagacggagatcctacgcgtcgtcgtacgcgagtccatgagtctt
gatctcctggatcgtttgatcacggatatctgcgcagtgaccgagagtgtcatgcagagt
gaccagatagacctttcagcgtggcagccatccaacagcagcgtcgagaaaactcatggt
agccgtggacttgatggcaaggacaagcacaaagcgaagagaccgatgcatcacggtgtg
cacagggctgtgtgctaa

DBGET integrated database retrieval system