KEGG   Neofusicoccum parvum: UCRNP2_891Help
Entry
UCRNP2_891        CDS       T03126                                 

Definition
(RefSeq) putative glutamate decarboxylase protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
npa  Neofusicoccum parvum
Pathway
npa00250  Alanine, aspartate and glutamate metabolism
npa00410  beta-Alanine metabolism
npa00430  Taurine and hypotaurine metabolism
npa00650  Butanoate metabolism
npa01100  Metabolic pathways
npa01110  Biosynthesis of secondary metabolites
Module
npa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UCRNP2_891
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRNP2_891
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCRNP2_891
   00430 Taurine and hypotaurine metabolism
    UCRNP2_891
Enzymes [BR:npa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCRNP2_891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19028649
NCBI-ProteinID: XP_007580214
UniProt: R1EX29
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MLASHVDPDELIQKFHDHPVHTRGFHSSNAVNHNTPYSSRYASTTELSKFKIPHDGAPAD
AVHQMLKDELDLDGRPNLNLASFVGTYMEEQAEKLMIENLSKNMSDADEYPAMMQMHARC
VSILAHLWGVQKGEKAVGTATTGSSEAIHLGGLAMKRRWQEKRRADNKPTDKPNIIMGSN
AQVALEKFARYFEVEARILPVSAKSRYRLDPDLVRENIDENTIGVFVILGSTYTGHYEPV
EEISKILDDYEAKTGVDIPIHVDGASGAFIAPFTHAGVGGPKWNFELPRVKSINVSGHKF
GLVYAGVGWIIWRDEAYLPKHLIFELHYLGGTEESYTLNFSRPGAQIIAQYYNLIHLGFT
GYRTIMENALSNARLLSRALEATGWYECVSDIHRKKGDFKYEEGKKPFDEGEDSAAYNSG
LPVVAFTLSKKFKEQYPHVRQVSVSNLLRAKQYIIPNYPLPPNEEKTEILRVVVRESMSL
DLLDRLITDICAVTESVMQSDQIDLSAWQPSNSSVEKTHGSRGLDGKDKHKAKRPMHHGV
HRAVC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaagccacgttgacccggatgagctcatccagaagttccacgaccaccccgtc
cacacccgcggcttccattccagcaacgccgtgaaccacaacaccccctactcgagccgt
tatgcctcgaccaccgagctctccaagttcaagattccgcacgatggagcccctgccgac
gctgtgcaccaaatgctgaaggacgagctcgatcttgacggccgtcccaatctgaacctt
gcctccttcgttggaacatacatggaggagcaggccgagaagctcatgatcgagaacctg
tccaagaacatgtcagacgcagacgaatatcccgcaatgatgcagatgcatgctcgctgc
gtgtcaattcttgcgcacctttggggtgtccagaaaggagagaaagccgtgggcacagct
acgaccggctcaagcgaggccattcatctcggtggtctcgccatgaagcggcgttggcaa
gagaagcggagggccgacaacaagcccacggacaagcccaacatcatcatgggatccaat
gcacaggtggcattggagaagtttgcccggtacttcgaagtcgaggcccgcatcctgccg
gtcagtgcgaagagtcggtaccgtctggacccggatctcgtgcgggagaacattgatgag
aacaccatcggtgtattcgtcattcttggatcaacctacaccggccactacgaaccagtg
gaggagatttccaagatcttggatgattacgaagccaagactggagttgacattcccatc
cacgtcgacggcgcctctggtgcatttatcgcgcctttcacgcacgccggtgtgggtggg
cccaagtggaactttgagcttccccgggtgaaatccatcaacgtttccggccacaagttt
ggtctcgtctatgccggtgttggatggatcatctggcgggacgaggcctaccttcccaag
catctcatcttcgagcttcactaccttggcggcacagaggaatcatacaccctgaatttc
tcacggccaggtgctcagatcattgcgcagtactacaacctgattcacctcggcttcacg
ggctaccgcaccattatggagaacgccttgtcaaatgctcgactgctgagtcgagctctc
gaagctaccgggtggtacgaatgcgttagcgatatccaccggaagaagggagatttcaag
tatgaggaaggaaagaagccctttgacgagggtgaagacagtgctgcctacaactctggg
ctgccagttgttgcgttcaccttgagcaagaagttcaaggaacagtatccgcatgtcagg
caggtctccgtcagcaacctgttgagagcgaagcaatacatcatcccgaactatcccctt
ccgccaaatgaggagaagacggagatcctacgcgtcgtcgtacgcgagtccatgagtctt
gatctcctggatcgtttgatcacggatatctgcgcagtgaccgagagtgtcatgcagagt
gaccagatagacctttcagcgtggcagccatccaacagcagcgtcgagaaaactcatggt
agccgtggacttgatggcaaggacaagcacaaagcgaagagaccgatgcatcacggtgtg
cacagggctgtgtgctaa

DBGET integrated database retrieval system