KEGG   Nanorana parkeri: 108784876Help
Entry
108784876         CDS       T04897                                 

Definition
(RefSeq) anionic trypsin-2-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
npr  Nanorana parkeri
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:npr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108784876
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108784876
Peptidases [BR:npr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108784876
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108784876
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MKTLLLLCVLGFAAAIPFDDDDKIVGGYTCNVPYQVSLNSGYHFCGGSLINEQWVVSAAH
CYKSRIEVRIGEYDIRAEDGTEQFIQSAKVIRHKDYNAYTIDNDIMLIKLSEPVQLNEVV
QPIPLPSQCAAVGAICLVSGWGNTMNTGENYPDLLQCVDVPVVSPEDCSKSYPGQITQNM
ICLGFPEGGKDSCQGDSGGPVALNGELQGVVSWGRGCAQPNYPGVYTKVCNFVSWIEDTI
TSN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccttctacttctctgtgttctgggctttgcagcggcaatcccttttgatgat
gatgacaagatagtaggtggatacacctgcaacgtgccataccaagtctccctgaattcc
gggtaccacttctgtggaggatccctaatcaatgagcaatgggttgtatctgctgctcac
tgctacaagtcacgcatcgaagtcagaatcggagaatatgacatcagagctgaagatgga
acagaacagttcattcagtcggcaaaggtcatccgtcataaggactacaacgcctacacc
attgacaatgacatcatgttgatcaagctgtccgagccagtccagctaaatgaagttgtt
caacccatccctctcccatctcagtgtgcagctgttggagccatatgtctggtatctggc
tgggggaacactatgaacaccggtgagaactacccagatcttctgcagtgcgttgatgtt
ccagttgtgtctcctgaggactgttcaaagtcttatccaggacaaattacacagaacatg
atttgcttgggcttcccagagggtggcaaagactcctgccagggtgactctggtggacca
gtggctctcaatggagagctccaaggtgttgtgtcttggggaagaggatgcgctcagccc
aattatcctggagtgtacaccaaagtctgtaatttcgtctcctggattgaggataccatc
accagcaactaa

DBGET integrated database retrieval system