KEGG   Nanorana parkeri: 108788253Help
Entry
108788253         CDS       T04897                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
npr  Nanorana parkeri
Brite
Enzymes [BR:npr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108788253 (HDAC6)
Protein phosphatases and associated proteins [BR:npr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108788253 (HDAC6)
Messenger RNA biogenesis [BR:npr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     108788253 (HDAC6)
Chromosome [BR:npr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108788253 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1236 aa AA seqDB search
MASPQERKSPEARGTSPPITTTKKPGKKGTSPPQCGPTLQEVKKRGQRIRKTPEMDICDQ
LDMLRLNRDLPAAGTGLVYDDRLTLPYCLWDDKFPEGPARILAVREKLAQYGLVDRCISV
PAREASDADLLLVHSPDFVELMKSTQTMTEEELRELSDRYDSVFLHPASFTTSCLAAGSV
LQLVDKVMKGEIRNGLAVVRPPGHHSHTDKMDGYCMFNQLAIAAKYAQRNHGVKRILIVD
WDIHHGQGTQFIFEHDPSVLYFSIHRYENGEFWPHLVESSSSAVGKDRGERYNINVPWNK
IAMTDADYITAFLHLLLPISYEFQPHLVLVAAGFDSVVGDPKGEMAATPACFAHLTHLLM
SLAEGRLILSLEGGYNLRSMSEGVCASLKILLGDPCPSLSQPFAPCDSALESISGAFCVH
RKYWRSLQEQDFTLKQERKAKETSQASLADTSEDTLTDVLDATMKEVMRKMPDQRTGLVY
DERMMEHYNMWDSGHPEVPQRIARIYLRHKEMGLLDRCVRLSQCAATKEQLQMCHSLPYI
DKIEGCSRLKPRDLHRMGDEYNSIYINNKSYSSACLAAGSTFSVVEAVLTGKVQNGVCIV
RPPGHHAEPGSACGFCFFNNAALAARYAQSLQNPSEPQLRVMILDWDIHHGNGTQHIFQE
DDSVLYVSIHRYDDGLFFPSSEDAAHDKVGVGLGEGFNVNIPWNGSKMGDSEYLLAFHRI
VMPIAYEFNPQLVLISAGFDAARGDPLGGCRVSPEGYAHMTHLLMGLAGGKVVVILEGGY
NLTSISESMSMCTRTLLGDPPPRLSDLHPPRPSALRTISNVLSVHNKYWCSLRLKVELPP
PSEISKEAHWTPQNVQSSPQLTTISPGRNIETQCPQELDLTGSKADDDSLNPSPEIVEVK
SPPSVAFSNGSIDSVSSIDSCSVSFSVENNMETPSSEKSQIMYRVGESSPQKSDSVKMAK
HELKETLVDKDDVFNPLLPNLAEVEKKEELVVEMEAVGPHSVHRDSNDGESLVTVMEVQV
SNRTPDILMSARTESSVEELVSDLKLEDSKDPSTFSIREGDSEPVAGARKTIVPFLQQVA
DGAEAASVSSPDTHLEENLLSEAASGCPASCYQIDVEPSLEFSGELFTVTPLPWCPHLES
VCEMPPCGLEVTQPCVACGTDIENWVCLTCYAVLCGRYVSQHMISHGVSSGHNLVLSFSD
LSVWCYSCDAYIHNEVLIPAKQSAYYSKFGEEMPGT
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccccaggagcgaaagtctccagaagctcgaggcacgtcccctcccatcact
accacgaaaaagcctgggaagaaaggaacctcccccccccagtgtggtccaacgctgcag
gaagtaaagaagagagggcaacgaatacggaagacaccggaaatggacatttgtgaccaa
ctagatatgctgcgcctgaacagagatctacccgcagcagggactggccttgtatatgat
gaccgactgactctgccatactgtctttgggatgacaaattcccagagggtcctgcacgc
atcttggcagttagagagaagctggcacagtatggtctggtggatcgctgtatttcagta
cccgctagagaggcgtctgatgcagatctcctgcttgttcacagtccggactttgtggag
ctgatgaagtccactcaaacgatgaccgaggaagaactcagagagctgtcagatcgctac
gattctgttttcctgcaccctgcttcgttcactacatcctgcttggctgccggctctgtc
ttgcagttagttgataaagttatgaagggagagatccgcaatgggttagcagtggtcagg
cctcctggacaccactcccacactgacaaaatggacggttactgcatgtttaaccaattg
gccattgcggccaaatacgctcagcgcaatcacggggtaaagcggatactgatcgtagac
tgggacatccatcacggtcagggaacacagttcatatttgaacacgatcccagtgtgttg
tatttttccattcaccgctacgaaaatggagaattctggccccatcttgtggagtcttcc
agcagcgcagtggggaaggatcgtggggagcgatataatatcaacgtgccctggaataag
attgcaatgacagatgctgattatatcacagcatttcttcacctcctcctcccgatctct
tatgagtttcagccacatcttgtattagtagcagctggatttgactctgtggtgggagac
ccaaagggagagatggctgccactccagcatgctttgctcacctgacacacctgctcatg
tccttggctgaaggaagacttattttgtcccttgagggagggtataacttgcgctctatg
tcggaaggggtctgcgcttccctaaagattctcctcggagacccttgtccaagtttgtct
cagccctttgccccctgtgatagtgccctggaatccatctctggtgccttctgtgtccat
aggaaatattggcggagcctgcaggaacaagatttcaccttaaagcaggaaagaaaagca
aaggaaaccagtcaggcttcactggcagacacatctgaagatactctaacagatgtgctg
gatgcaacgatgaaggaagtgatgaggaagatgccggatcagcgcactggcctggtgtat
gatgagcgcatgatggaacattacaacatgtgggacagtggccaccctgaggttccacaa
agaattgcccgcatatacctacgtcataaggagatggggctgttagatcgctgcgttcgc
ctctcccaatgtgctgcaaccaaagaacagctacaaatgtgccacagtcttccctacatt
gataagatagaagggtgttcccgactgaaacccagggacctgcatagaatgggagatgag
tataactccatctacatcaacaacaagtcttacagcagtgcctgtctggctgccggctcg
acattcagtgttgtggaagctgtccttacagggaaggttcaaaatggagtctgtatcgtt
cgcccaccaggtcaccatgcagagccaggttcagcttgtggtttctgcttcttcaacaat
gccgcccttgctgcacgatatgcccagagcctgcagaacccgtctgaacctcaattaagg
gtaatgattctagactgggacatccaccacggcaacggaacacagcacattttccaggag
gatgatagtgtgctgtatgtgtccatccatcgatatgatgatggcctcttcttcccatct
tctgaggatgctgcacatgacaaggttggcgtcggtcttggagaagggttcaatgtgaac
atcccgtggaatggtagcaagatgggtgattcagagtacttgctggcctttcataggatt
gtcatgcctattgcttatgagtttaatccgcagctggttttgatatctgctggttttgac
gctgctcgtggagacccacttggaggctgccgtgtttctccggaaggctacgcccacatg
acacaccttctgatgggtctggcaggtggcaaggtggtggtcattttggagggtggctat
aatctgacctccatttcagaatccatgtcaatgtgtactcgtacacttcttggagatccc
cctcctcgcttgtctgacttgcatcctccccgtccttcagcactgcgtacaatctcaaat
gtcctaagtgtccataacaaatactggtgcagcctcaggttaaaagttgagctccctcca
ccctctgagatatcaaaggaggcacattggactccacagaacgtgcagtcatccccgcaa
ctgacaaccatctcccctggaaggaatattgaaacacagtgtccccaggaattagatttg
actggttccaaagctgatgatgatagtctgaaccccagccctgaaattgtggaggtgaaa
agtccaccgtcagtagcctttagtaacggctcaattgatagtgtctccagcatcgacagt
tgttctgtatcattctctgtagaaaacaatatggaaacaccatcatcagagaaaagtcag
atcatgtaccgtgtcggggagtcttcacctcaaaaatcagacagtgttaaaatggctaaa
catgaactgaaagagaccttggttgataaggatgatgtctttaatcccctcttgcctaac
ttagctgaagtagagaagaaggaagagttggtggtagagatggaggctgttggaccacac
tcagtgcacagggattctaatgatggagagtcgctggtaacagtaatggaagtccaggtt
tcaaaccgaacaccagacattctgatgtctgccaggacagagagctctgtggaagaactt
gtaagtgacttgaagctggaagatagcaaagacccatcaaccttcagcattagagagggt
gacagtgaacccgttgctggggctagaaagacgattgttcccttcctgcagcaagtggct
gatggtgcagaagcagcttctgtgagttctccagatactcacttggaggagaatttactc
tcagaagctgccagtggctgcccagcctcatgttaccagatagatgtggagccatcactg
gaattctctggggagttgtttacggtgacgccacttccctggtgtcctcatctggagtca
gtgtgtgagatgcccccttgcgggctggaggtgacacagccgtgcgttgcttgtggtaca
gacatagagaactgggtgtgcctgacatgttatgcggttctgtgtgggaggtatgtctct
cagcacatgatatctcatggagtctcgtccggtcacaatcttgttctcagcttctctgac
ctgtctgtctggtgttacagctgtgatgcctatatccataatgaggttctgattccagca
aaacagtcggcctactactccaagtttggcgaggaaatgccaggaacataa

DBGET integrated database retrieval system