KEGG   Nanorana parkeri: 108789810Help
Entry
108789810         CDS       T04897                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:npr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108789810 (SETDB1)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108789810 (SETDB1)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108789810 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108789810 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537 DUF489 Tudor-knot
Motif
Other DBs
NCBI-GeneID: 108789810
NCBI-ProteinID: XP_018415412
LinkDB All DBs
Position
Unknown
AA seq 1265 aa AA seqDB search
MDESDVSDLENMVVEELGISMKELEEFIDKEVEKNEFVKQRKAQLLELEQLVKQKEEEVA
HVDSLCDNASRALEDCEMLVKTLYSEMGITYKETSSDDDESSKPVEVIEIPDEDEDDDDV
VSVGSGEAVVSKVPKEKRLLKDAMAAMKRCQKDVQNLVEAIHKKPVIVLDGPQTRLSSHP
SSPSSSVGGPNQTSTANDMKKDGDLVVGMRILGKKRTKTWHKGTLISIQMVGAGKKYKVK
FDNKGKSLLSGNHIAYDYHPPLDKLFVGSRVVARYKDGNQVWLYAGIIAEPPSNKNKMRF
LIFFDDGYASYVTHSELYPICRPLIKTWEDIEDVSCRDFIEEYVTAYPNRPMVLLKSGQL
IKTEWEGTWWKSKVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQEKKQ
AGQQRTRPNVGAVRSKGPVVQYTHDLTGSESPYKTTEPSSPQSIPSPQLIDTDSDSQQAQ
SKKQVAKKSTSFRPGSGGSGPSSPVPSEPPPTVRPVQQNQTNQMQIQTVHTIQAIQTIPT
IHAIQTNQTIQIAQSQRFVANVAQIQVLQTNALPTEITYKAPTEKLFYLRHNCSHACLSR
VRNISHRIRNPLLVPLLYDFRRMTARRRVNRKLGFHVLYKTPCGLSLRTMPEIERYLFET
TCDMLLLEMFCLDPYVLVDRKFQPQKPFYYIPDITYGKEDVPLSCVNEIDRTPPPQVAYS
KERIPGRGVYINTGQDFLVGCDCTDGCRDRSKCACHQLTLEATGCTPGAQINTQAGYQHK
RLEECLPTGVYECNKRCKCNHNRNLCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKG
SFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENYKDGYESDVKSSSDSSGVDIK
HQGEEHSGTEDQDESQDDSSDDNFGKNEDITTSSVWRSYATRRQTRGQKENGTVDTSSKD
SALARQTSQEETTDCKLPEETSKNKVASWLSSNTDSFLDPDSRSSLKLGDAADIEKQGKK
EEPAKDTEDSKPAGESNRSYGYNPTPAKPEGIKRPLSKTAMHQIRRQSNAHSNEDVLTLS
SSSGSDVGSGANKKPTTQTNANDSDDVQTISSGSDVDEDKKHITTTTGPVKRQVAVKSTR
GFALKSTYGMTVKPNMASADRGEGMIGRRTTRQFYDGEESCYIIDAKLEGNLGRYLNHSC
SPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKKLLCCCGSTEC
RGRLL
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatcagatgtgagcgatctggagaacatggtggtggaggagttgggaatctct
atgaaggagctcgaggagttcatagacaaggaggtggagaagaatgagtttgtgaagcag
cggaaggcacagttgttggagctggagcaactggtgaagcagaaggaggaagaggtggcc
catgtggacagcttgtgtgacaatgcttcaagggctctcgaggactgcgaaatgttagtg
aaaacgttgtacagtgagatgggcatcacatacaaggagaccagctcagatgatgatgaa
tcctccaaacctgtggaagtcattgaaatcccagatgaggatgaggacgatgatgatgtc
gtgagtgtgggatcaggtgaagcagttgttagtaaagttcctaaagagaaacgactgtta
aaagacgctatggctgccatgaagaggtgccagaaagatgtacagaacttggtggaggcc
attcacaagaagcctgtcattgttttagatggaccccaaactcgcctgtcctctcatcct
tcttcgccttcaagttctgtgggtggtcccaaccagacctccacagccaatgacatgaaa
aaggatggagaccttgttgtgggtatgaggattcttggtaagaagaggaccaaaacatgg
cacaaggggaccctgatttccattcagatggttggagcaggaaaaaaatacaaagtcaaa
tttgacaacaaagggaagagcctgctgtccggcaaccatatagcgtatgattaccaccca
ccactagataaactgtttgttgggagcagagtggtggccagatacaaagatggcaaccag
gtatggctctacgctggcatcatagctgaacctcccagcaacaagaataaaatgagattt
ctgatcttcttcgatgacggctatgcttcctatgttacacactcagaactataccccatt
tgcaggccattgatcaaaacctgggaagatattgaagacgtgtcctgccgtgacttcatc
gaagaatatgtcactgcgtaccctaaccgacctatggttctgctgaaaagcggccagctg
ataaaaacagagtgggagggcacctggtggaagtctaaagtggaagaggttgatggaagc
ctggtgaagattttattcttggatgacaagcgttgtgagtggatctatcgaggctccacc
cgcctggagcccatgttcagcatgaagacctccacagcttccactcaagaaaaaaagcag
gcaggacagcagcgaacacgtcctaatgtgggtgcggtgcggagtaaaggacctgtggta
cagtacacacacgatcttactgggagtgaatctccttataaaactacagagccaagctca
ccccagtcgatcccatcaccacaacttatcgacacagactctgacagccagcaggctcag
tccaagaagcaagttgcaaagaaaagtacatcgttccggccaggatctggaggctccggg
ccatcgtctcctgtacccagtgagccgcctcccactgtgcggcctgtccaacagaatcag
accaaccaaatgcagattcaaactgttcacaccatccaagctatacagactattccaaca
atacatgccattcagactaaccagacgattcaaatcgcacagtctcaaagatttgtggcc
aacgtggcacagattcaagtccttcagacaaatgcattgccgacggagatcacttataag
gctcccacggagaagctgttttacctacgccacaactgtagccacgcatgcttatcccgt
gtccgtaacatatcacatcggatcaggaaccctctgctggtgccactgctgtatgacttc
cgccgtatgaccgcacggcggcgggttaaccgcaagctgggattccacgtcctctacaaa
acgccgtgcggcctcagcctgcgaaccatgcctgagatcgagcgttaccttttcgaaaca
acctgtgacatgctgctgttggaaatgttctgcttggacccctatgttctggtggaccgc
aagttccagccgcagaaacctttctactatatccccgatatcacatacggaaaggaggat
gtgccgctctcctgcgtcaatgagatagacaggacccctcctccacaggtggcatatagt
aaggagcgcattcccggcagaggagtatatattaacacgggccaggactttctggtggga
tgcgactgcacggatggatgccgagacaggtcaaaatgtgcctgtcaccaactgacgttg
gaggccactggctgcacgccgggagcgcagattaacacacaagctggataccaacacaag
cgtctggaggagtgtcttcctacgggggtgtatgaatgcaacaagagatgtaaatgcaat
cacaatcgaaatctatgcacaaaccgcttggttcagcatggcctccaagtgcgtctccag
cttttcaaaacgcaaaacaaaggttggggtattcgttgtctggatgacattgcaaaaggg
tctttcgtctgtatatatgcaggtaaaatcctgacagatgactttgcagacaaggaaggg
ttggagatgggagatgaatactttgcaaatttggaccacatcgagagtgtagaaaactac
aaggacggttacgaaagtgatgtcaagtcgtcttcggatagcagcggcgtagacatcaag
catcagggggaagaacacagcggcacagaagatcaggacgagtcccaagacgacagttcg
gacgacaattttggaaagaacgaggacatcacaaccagctctgtatggcggagctatgct
acacggcggcaaactaggggacagaaagagaacgggactgtagacacctcctctaaggac
tctgctctagccagacagaccagccaagaggagaccacagactgcaaactgcccgaggag
acctccaagaacaaggttgcttcttggttgagctctaacacggactcatttttggaccct
gatagccggtcgtctctcaaattgggggatgcagcagatatagagaagcaggggaagaag
gaggaacctgccaaggatactgaagacagcaagcctgctggggagagcaatcgatcgtat
ggttataatccaacgccagctaagcctgagggcatcaaaaggccactgagcaaaaccgcc
atgcaccagatcagacgccagtccaatgcccactctaatgaagatgtgctgaccttgtcc
agcagttcggggagtgatgtcggcagtggggcaaacaagaagcccaccacccagactaat
gccaatgacagcgacgatgtccaaaccatttcttctggttctgatgtagacgaggacaag
aagcacataaccactactaccggcccagtgaagagacaagtggctgtaaaatccacccgc
ggctttgccctaaaatccacctatggcatgacagtgaagcccaacatggcatctgcggac
agaggcgaaggaatgattggccggaggacaacgcggcaattttacgatggggaggagtct
tgttacattatcgacgccaaacttgagggaaatttgggtcgatacttgaatcacagctgc
agtcccaacctgtttgtacagaatgtgtttgtggacacacatgacctgcgatttccctgg
gtggctttcttcgccagcaagaggatacgggccggcacggagctgacctgggattataac
tacgaggtggggagcgtggaaggcaagaagctgctgtgttgctgcggatccacagaatgc
cgggggcgcctcttgtaa

DBGET integrated database retrieval system