KEGG   Nanorana parkeri: 108791923Help
Entry
108791923         CDS       T04897                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
npr  Nanorana parkeri
Brite
Enzymes [BR:npr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108791923 (F13A1)
Cell adhesion molecules and their ligands [BR:npr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     108791923 (F13A1)
   VLA-9
     108791923 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 740 aa AA seqDB search
MSDPKQTKEEKKKKPEGYKGRRSVPPNVSNAGEDEVPTMETFGVIPRGVNMKDYLEVEYV
ELYKQQYEKNKQEHHTDRYFNNKLIIRRGQKFDIRIGFNRPYNPEKDQFWVEYVIGRYPQ
QSKGTYIPIPIVKEPEVGKWGAKITHIEDNSVSLTILSAPDCIIGKFRMYVAVLTPYGIL
RTPKRSDTDTYILFNPWCKEDAVYMDDASEIEEYVMNDVGVVFHGELNNIKTRPWEYGQF
EEQILDACLFVMDKAELDLSGRGNPIKISRVGSAVMNARDDDGVISGNWNNDYTYGVAPS
AWTGSVDILLEYFSSGLSVKYGQCWVFAGVFNTFLRCLGIPARLVTNYFSAHDNDANLQT
DVYLDEDGKTNTSLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQAVDATPQETSDGMFRCG
PASVQAIKHGHVCFQFDTPFLFSEVNSDVVYSKAMKDGSKVVEYIDKTHVGQKILTKEIG
GNGPHEITDLYKFSEGCEEERLALEAALMYGVKKEIREELQPLTELETTMDFQEDNAIFG
SDFKVTLTFKNKSSNLYTVSAYLTGHVVFYTGVLKSEFKNKTIEVTLDPLSNKTVDVNIK
ASEYMSHLVEQASLHFFVTARINETRKIMAKQKIVVLQVPELRIKTIGDKMVGKEMKVVV
EFTNPIKKKLQNVVXXXXXQWRTRPVFKLRREVSGNAVLTWEEICIPRRAGTRKLIATLD
SDTLRHVYGELDLEILSGAY
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctaaacaaactaaggaagagaaaaagaagaaaccagagggttataaaggt
cgtagatctgtacctccaaatgtgtccaatgctggtgaagatgaggttcccaccatggaa
acttttggagtcatcccaaggggtgtcaacatgaaagattacctggaagttgagtatgtt
gagctgtacaagcaacagtatgaaaaaaataaacaagagcatcacacagaccgatacttc
aacaacaaactcatcatacgccgtgggcaaaaatttgacattagaattggcttcaaccgg
ccatacaatccagaaaaggaccagttttgggtggaatatgttattggtcgctacccgcaa
caaagtaaaggcacatacattccaattcctattgtgaaggaaccagaagtaggaaaatgg
ggagcaaaaattactcacattgaagataactccgtcagcttgactattttatcagctcct
gactgcatcataggcaaattccgcatgtatgttgctgttttaaccccgtatggtattctg
aggacacccaaacgatctgacaccgatacgtacattctctttaatccctggtgcaaagag
gatgctgtttacatggatgatgcaagcgaaatagaagaatatgtaatgaatgatgtaggt
gtcgtttttcatggagaattgaataatattaagacacgaccctgggagtatggacagttt
gaagaacagatacttgatgcttgcctatttgtaatggacaaagctgaattagatctctca
ggcagaggaaaccctatcaagatcagtcgtgttggatcagcagtgatgaatgccagagat
gatgatggtgtgatttctggaaactggaataatgattatacctatggtgttgctccatct
gcttggactggaagtgtagacatcctactagaatacttcagttctggcttgtcagtcaaa
tacggacaatgttgggtcttcgctggtgtatttaatacatttttgcgatgtcttggaatt
cctgcacggcttgtcaccaattatttctctgctcatgacaatgatgctaatctacaaacc
gatgtctacttggatgaagatggaaaaaccaatactagccttaccaaggacagcatctgg
aattatcattgctggaatgaggcttggatgacccgaccagatcttccagttggttttgga
ggatggcaagcagtggatgccacaccacaggagactagtgatggtatgtttagatgtggc
cctgcatctgttcaagccattaaacatgggcacgtctgctttcagtttgatacgcctttc
cttttctctgaggtaaacagtgacgttgtttattctaaggcaatgaaagatggatcaaaa
gtggttgagtatatcgataaaacacacgtgggacagaaaatattaacaaaggaaatagga
ggaaatggacctcatgaaataactgatctgtacaagttctcagaaggctgtgaagaggag
agacttgcactcgaagcagctctcatgtatggtgtcaaaaaggaaatccgagaagagcta
cagccactcaccgagcttgagactacaatggactttcaggaagataatgcaatatttggc
agtgacttcaaagtcactttaacattcaagaacaaaagctccaatctgtatacagtatca
gcttatctaactggacatgttgtattttatactggagtcctgaagtcagaattcaagaat
aaaaccattgaagtaaccctggatcctttatctaataaaacagtggacgttaatataaaa
gccagtgagtacatgagccatcttgtggaacaggcatctttacacttcttcgtcacggct
cgtatcaatgaaacaaggaagataatggccaagcagaagattgtagtattgcaagttcct
gagctgcgcattaagactattggagataagatggttggtaaggaaatgaaagtggtggta
gaattcactaacccaataaagaagaaacttcagaacgttgtcttnnnnnnnnnnntccag
tggaggacaagacctgtattcaagctaaggagggaagtctcaggaaatgcagtcctgact
tgggaagaaatatgtatcccaagaagagcgggcaccaggaaacttattgcaactctagat
tcggacaccctaaggcatgtgtatggcgagctggatttggagatcttgagtggagcctat
tag

DBGET integrated database retrieval system