KEGG   Nanorana parkeri: 108793387Help
Entry
108793387         CDS       T04897                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5-like
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
npr  Nanorana parkeri
Brite
Enzymes [BR:npr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108793387
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MAQVLDVAYTDFQCQKNNKLHHTIEISDRRLILRRGQPFSIVIHFKTRGFEEGTDNILCI
AETGPWPDQPSGTKVVFPITKALNRRAWSAAVESNGSDSMVMVIMPSSNAIIGQYSLKVQ
FSMGKKATVYQLGVFALLFNPWCADDDVFLDNEAKRQEYIINDYGFIYQGNHNWITPSPW
NFGQLEEDILDISFKLLDKNLNYLQDAFKDLSSRNNPVYISRIVCAMINSNDDNGVIQGN
WSEKYENGTCPSSWNGSVAILRQWFKADCHPVKYGQCWVFAAVMCTVMRCLGIPTRVVTN
FDSAHDTNSNLVIDEYYDSTGKKLPQESRDSIWNFHVWCECWMARRDLPLGYGGWQVLDP
TPQETSDGIYCCGPASVKAIREGDVHLNYDCPFVFSMVNADCVSWILYGTKKEKHFSDPH
YVGNHISTKCVGTDEREDITDNYKYDEGTIEERKVNLKALRRLKQRDTMMHSNGGAYSSN
TNDFAVNGVQPGEGNASQNGSLNEHRNPPLQDVKLILKFKLVESPQLGQTINLALQAANL
RSVAKTLKLCFSAQAVKHTGKPGHQFWKESKYIDFEPSEEKWTFFRIPFSQYGKYLDDNN
LIRVTAVGEQNVTWEKLLVQKDINLALPQIVINFLGSPVVNKPCKVRLMFSNPLDEDIKD
CLLVIEGSGLMKTQLKVIVDTMKRKQKSVLEFEVVPCKPGLKQLQVNFSSNKFQVLKGYK
TVVVNPA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtactggatgtggcctacacggactttcaatgccagaagaacaacaaattg
catcatacgatagaaattagcgacaggcgtcttatccttcgcagaggacagccgttttca
atagtcatacacttcaaaacaagaggatttgaagaagggacagacaacattctctgcatt
gctgagacaggaccgtggcctgaccaaccttctggaacaaaagttgtattccctataaca
aaggctttaaacagaagagcctggagcgcagcggtggagtccaatggatccgactcaatg
gtgatggtcatcatgccgtcatccaatgctattattggacaatactctctaaaggttcaa
ttttctatgggtaaaaaagccacagtttatcagctaggagtgtttgctttgctattcaac
ccctggtgcgcagatgatgacgtcttcctggataatgaagccaagaggcaggaatacatc
attaatgactacgggtttatttatcaaggcaaccacaactggatcactccttctccatgg
aactttgggcagcttgaagaagacatcttggatataagctttaagctgttagacaagaat
ttaaattacctacaagatgcttttaaggatttatctagtagaaataatcctgtatacata
agtcgaatagtgtgtgccatgattaactccaatgatgataatggagtcattcaaggaaac
tggagtgaaaaatatgaaaatggcacctgtccttcctcgtggaatgggagtgttgccatt
ttaagacaatggttcaaggcagactgccacccagtcaaatatggccagtgctgggtcttt
gctgcagtcatgtgtacagtaatgagatgtttaggaattccaacccgagttgtaacaaac
ttcgactctgctcacgataccaatagcaatcttgtaattgatgaatattatgattcaact
ggcaagaagctcccccaggaaagccgtgacagcatctggaacttccatgtctggtgtgag
tgctggatggcaagaagagacttgcccctaggctatggaggatggcaagttctagatcca
actccacaggagacaagtgatggtatttactgctgtggccctgcctctgtaaaagccata
agagaaggggatgtccacctgaactatgattgcccattcgtcttttccatggtgaatgca
gattgtgtgtcatggatattatatgggacaaagaaagaaaagcatttttctgatccccat
tatgttggaaatcatatcagcacaaagtgtgttggaacagatgaacgagaagacatcact
gacaactataaatatgatgaaggaaccattgaagaaagaaaagtgaacctaaaagcacta
agaagactaaaacagagagacactatgatgcactctaatggtggtgcatactctagcaat
accaatgactttgctgttaatggcgttcaacctggggaaggaaacgcatctcagaatgga
tccctcaatgaacatcggaatcccccattgcaagatgttaaactgattctaaagtttaaa
ctggtggagtctccacagctgggacaaacaataaacttagccttacaagctgctaactta
cgttctgttgccaagaccctgaagctgtgttttagtgcacaagctgtgaagcacacaggc
aaacctggacaccagttctggaaggaatccaagtacattgattttgagcccagtgaagag
aaatggacctttttccgaatcccattttcacaatatggaaagtaccttgatgacaacaac
ttgataagagtgacagctgttggcgagcagaacgtgacctgggagaaacttctagtacaa
aaggatattaacctggctcttccacaaatcgtgatcaatttcctggggtctcctgtagtg
aacaaaccatgcaaggtgcgtctgatgttctccaatccccttgatgaagacattaaagac
tgtctactggtaattgaaggcagtggtctgatgaagactcaacttaaagtaattgttgac
accatgaagaggaagcaaaaatcagttttggaatttgaggtggttccctgcaagccaggc
ctcaaacagctccaagtgaacttcagtagcaacaagtttcaggtcctgaaaggctacaag
accgttgtagtcaaccctgcataa

DBGET integrated database retrieval system