KEGG   Nanorana parkeri: 108795794Help
Entry
108795794         CDS       T04897                                 

Definition
(RefSeq) putative hexokinase HKDC1 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
npr  Nanorana parkeri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108795794
   00051 Fructose and mannose metabolism
    108795794
   00052 Galactose metabolism
    108795794
   00500 Starch and sucrose metabolism
    108795794
   00520 Amino sugar and nucleotide sugar metabolism
    108795794
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108795794
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108795794
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108795794
Membrane trafficking [BR:npr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108795794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MFAVHLISFWFTKLKEDQLKKVDRFLYHMRLSDENLLDIMARFQVEMDKGLKKDTNSTAS
VKMLPTYVRTTPDGSEKGDFLALDLGGSKFRVLKVKVSEDGKQNVHMDSQFYPTPNEIIT
GNKTELFEYVANCLGDFMKKRQITEKLPLGFTFSFPCKQTKLDEGVLINWTKEYKVRGMQ
EKDVVETLRKTLKKKKFTNVEVMALVNDTVGTMMTCGYDDHLCEVGVIVGTGTNACYMEN
LSNIDLVEGDEGRMCINTEWGAFGDDGSLEDIITEFDKEIDLGSLNPGNQLFEKMISGLY
MGELVRLILLKMAKKGLLFGGKVSTALRTKGAVATSHVASMEKYNEGLYNTRQVLLDLGL
EPSEDDCIAVQHVATIVSFRSANLCAAALAAILTRLRQNKKLDRMRTTVGMDGTVYRTHP
QYAKRLHRVVRRLVPNCDVRFLLSESGSGKGAAMVTAVACRLLTQHKQIDEVLDLFHVND
EKLADIKLRMMTELKYGLQKETHDKATVKMLPTYVYGTPDGTEKGKFLALDLGGTNFRVL
LVKIHSGRRRYVKMYNKIFAIPLEIMQGTGEELFDHIVECIAEFLDYMGIKGAPLPLGFT
FSFPCRQDQIDKGTLVGWTKGFKATECEGQDVVDLLREAIKRRNEFDLDIVAIVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNVCYMEEMKNIEFLEGDEGRMCINTEWGGFGDNGCLSYI
QTPYDRDVDEKSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKKGLLFRGQISERLRTKGI
FETKFLSQIESDRLALLQVRKILQQLGLDSTCDDSIIVKEVCGAVSTRAAKLCGAGLAAV
VDKIRENRGLDHLKTTVGVDGTLYKLHPHFARILQETVKKLAPECDVTFILSEDGSGKGA
ALITAVAKRFHSQGEEDNNPIDLNI
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtacatttgatatcattttggtttacaaagctgaaggaggatcaactaaaa
aaggttgatcggtttctgtaccacatgcgtctgtcagatgaaaacttactggatataatg
gctcgtttccaagtagagatggacaaaggtctaaagaaggacacaaactcaacagcatca
gtgaaaatgttgcccacttatgtcaggaccactcctgatggttcagaaaaaggggatttc
cttgcccttgatctgggtggctctaagtttagagttctgaaagttaaagtgtctgaagat
ggaaagcagaatgtacacatggacagtcagttttacccaactcccaatgagataatcact
ggaaataaaacagaacttttcgaatatgttgccaactgtcttggagatttcatgaagaag
agacaaataacagagaagcttccacttggattcaccttctcatttccatgcaagcagacc
aaacttgatgagggggtgttgattaactggacaaaggagtataaagtaagaggcatgcag
gaaaaggatgtggtggagacactgcgtaaaaccctgaagaagaagaagttcacaaatgtg
gaagtcatggccctggtcaatgacacagtgggaacaatgatgacgtgtggatatgatgac
cacctgtgcgaagtcggagtcattgtagggactggtaccaatgcttgctacatggagaac
ctgagtaacattgaccttgttgaaggtgatgaaggaaggatgtgcatcaacacggaatgg
ggagcatttggagatgatggatccctggaggacattataactgagtttgataaagaaata
gatttaggatctcttaaccctggaaatcagctatttgagaagatgatcagtggtctgtac
atgggagaacttgtccgactcattctgctgaagatggccaagaaaggtcttctgtttggt
ggaaaagtctcaacagctctccgtaccaagggtgcggtagcgaccagccatgtggcatcc
atggagaaatacaatgaggggctgtataacaccaggcaggtattgcttgacctcggactg
gagccatcagaagatgactgcattgctgtacagcatgttgccaccattgtgtcattcaga
tcagccaatctgtgtgcagcggctctggctgccatactcacccgacttcggcagaataag
aagttagacaggatgaggaccacggttggaatggatggtacagtttatagaactcatcct
caatatgctaaacggctccacagggtggtcaggagactggtccccaattgtgatgtacgc
ttcctgctgtcagaaagtggcagtgggaaaggagcagctatggttacagcagtcgcttgt
agacttctgacccaacacaagcagattgatgaagtactagacttgttccatgtcaatgat
gagaaacttgcagatattaagctgagaatgatgacggaactaaaatatggacttcagaag
gaaactcatgacaaagccacagtgaaaatgttaccaacatatgtgtatggaacacctgat
gggacagagaaaggaaagtttctggctttggatcttggaggaacaaacttccgagtattg
ctagtgaagatccacagtggaagaaggcgctatgtgaaaatgtacaataagatctttgcc
attcctctggagataatgcaaggaactggagaagagctctttgatcatatagtggaatgc
attgcagaattcctagactacatgggaattaaaggtgctccattacccttgggatttaca
ttttctttcccatgtagacaagatcaaattgacaagggaactctggtgggatggacaaaa
ggtttcaaagccacagaatgtgaagggcaagacgtagtagatttgttgcgggaagccatc
aagagaagaaatgagtttgacttggacattgtggccattgtcaatgacacagttgggaca
atgatgacctgtgggtatgaagacccaaactgtgaaattggactcattgcaggtacagga
agcaatgtgtgttacatggaagagatgaagaacattgagtttttggagggagatgaaggg
agaatgtgtataaacacagaatggggaggttttggagacaatggttgcttgtcttacatc
cagaccccatatgacagagatgtggatgagaagtcactaaatccaggaaagcaaagatat
gaaaagatgactagtggcatgtacctcggagaaattgtgagacaaattttaattgaccta
accaaaaaaggtctcttatttcgcggtcagatatctgaaaggctgaggacaaaagggata
tttgaaacaaaatttttgtctcagatagaaagtgatcgtctagccctccttcaagtcagg
aagattctgcagcagctgggtttggacagtacatgtgatgacagtatcattgtaaaggaa
gtttgtggagctgtatcaacaagagcagcaaagttatgtggagctggcttggcagctgtt
gtagataaaataagagaaaaccggggcctagaccatttaaaaaccactgttggtgttgat
gggaccttgtacaaattgcatccacatttcgccaggattttgcaggaaacagtgaagaaa
ctggcaccagaatgtgatgtgacgtttatactatctgaagatgggagcgggaagggagca
gcactgattactgccgtggccaaacgttttcacagtcagggagaagaggataacaatcct
attgacctaaacatttaa

DBGET integrated database retrieval system