KEGG   Nanorana parkeri: 108805018Help
Entry
108805018         CDS       T04897                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
npr  Nanorana parkeri
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108805018 (PTGS1)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108805018 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MAGGRFVLLLVIMNVPWSFQTSDTVNPCCYFPCQHKGVCVRFDLDKYECDCTRTGYYGRN
CTIPELWSRIREFIRPSPAFSHYILTRFKWFWDIINATFIRDTIVRLVLTVRSNLIPSPP
TYNSAYGYISWEAYANVSYFTRVLPPVPDDCPTPMGTKGKVQLPNSTLLVETFLKRKRFI
PDPQRTNLMFAFFAQHFTHQFFKTFGRMGRGFIKGFGHGVDLSHVYGDTLERQHTLRLFK
DGKLKHQIINGDMYPPTVIDAPVHMIYPESIPKEKQLAMGQEVFGLLPGLMMYATLWLRE
HNRVCDVLKEEHPTWGDEQLFQTTRLILIGETIKIVIEDYVQHLSGYFLKLKFDPELLFG
VQFQYRNRIAVEFNHLYHWHPLMPDSFSIMGQDYNYSHFIYNYSMLTDYGVEALVESFTK
QIAGKIGGGNNLHPHLLYIAAGVIEESRKLRLQSFNEYRKRFGLKAYKTFRDFTGEDEVS
ARLEELYGDIDALEFYPGLLLEKTHPNSIFGESMIEMGAPFSLKGLMGNPICSPEYWKPS
TFGGETGFNMVKTASIEKLVCRNVKRCPEVAFHVLDPEPGGRHPSREKKSGDEL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggacgtttcgttctactgttggtgatcatgaacgtgccctggtccttccag
acttctgatacagtgaacccatgctgctacttcccatgccagcacaaaggtgtgtgcgtg
agattcgacctggacaaatacgaatgtgactgcactcgcaccgggtactacgggagaaac
tgcaccatccctgaattatggtcaaggattcgtgaattcatccgcccaagccctgcgttt
tctcactacatcttgacccgcttcaagtggttttgggatatcataaatgctacttttatc
cgcgatacaatcgtaaggctcgttttgacagtgcgatccaatctgatacccagcccccca
acctataactcggcatatggttacattagctgggaagcatatgctaatgtaagctacttc
acaagagttctaccccctgtgcccgatgattgtcctacgccaatgggaaccaaaggaaag
gtacagctgcccaactccacgttactggtggagaccttcttaaagaggaagcgcttcatc
ccggaccctcagagaaccaacctcatgtttgccttcttcgcccagcatttcacccatcag
tttttcaagaccttcggaaggatggggcgagggttcatcaaaggatttggtcacggggtg
gacctcagtcacgtgtacggggacacgctggaacgtcagcacacgcttcggctatttaaa
gacggaaagctgaaacatcagataataaatggagatatgtatccaccaacagtgatcgac
gctcccgtccacatgatctacccggagagcatccccaaggagaagcagctcgccatgggg
caggaggtgtttgggctcctccccggactgatgatgtacgccacgctttggctccgcgag
cacaaccgggtctgcgacgtcctgaaggaggaacaccccacgtggggggacgagcagctc
ttccaaaccaccaggctgattctcatcggagagaccataaaaattgtcattgaggactac
gtccagcacctcagcgggtacttcctgaaactgaagttcgatccggaattgctattcggg
gtccagttccagtaccggaaccggatcgccgtggagttcaaccatttgtatcactggcac
cccctaatgccggacagcttctccatcatgggacaagactacaactacagtcacttcatc
tacaactactccatgctgacggactacggcgtggaagctctggtggagtccttcaccaag
caaattgccggaaagattggaggcgggaacaatcttcacccacatctgctatatatagct
gccggggtcatcgaagagtcccgcaagctgaggctgcaatctttcaacgaataccggaag
aggttcgggctgaaggcgtacaagacgttccgggatttcacaggggaagacgaggtctcg
gcccggctggaggagctgtacggcgacatcgacgccctggagttctacccgggcctcctg
ctggagaaaacccaccccaactccatcttcggggagagcatgatcgagatgggagccccc
ttctccctcaaaggactcatggggaaccccatctgctccccggagtactggaagccgagc
accttcgggggggagacgggcttcaacatggtaaagaccgcctccatagagaagctggtg
tgccggaacgtcaagaggtgcccggaggtcgccttccacgtgctggacccggagccggga
ggccgccacccttcccgggaaaagaagagcggcgacgagctttag

DBGET integrated database retrieval system