KEGG   Nostoc punctiforme: Npun_F3356Help
Entry
Npun_F3356        CDS       T00713                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
npu  Nostoc punctiforme
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
4181873..4183702
Genome map
AA seq 609 aa AA seqDB search
MTLSYLRDSEYSVSTLVDVLIYRAKHQPEQKAYTFLKNGEQEADSLTYQELHLRSRAIAG
SLQALNLVGERALLFYQPGLDFIAAFFGCLYAGVVAVPAYPPRKNQNLSRLQAITADAQA
QIVLTTTTLLNNRELFAEQELELGQLQWLTTDVLTNELTQSWQQLKLEENSLAFLQYTSG
STGNPKGVMVSHGNLLHNSRAIAQCFGHSSNSKGLIWLPPYHDMGLIGGILQPLYAGFPV
VLMSPVDFLQKPIRWLQAISRYKATTSGGPNFAYELCLRKATPEHLESLDLSSWDLAFTG
AEPIRAQTLEQFTKTFAPCGFNQKAFYPCYGMAETTLIVSGGEKTELPILCKVDPAALEQ
NRVVNVIDEQIDARTLVGCGQSCQDMSIVIVNPESLSVCSEKQIGEIWISGSSVTQGYWN
QAELTEKNFYAYADMGEGPFLRTGDLGFLQDDELFVTGRIKDIIIIRGQNHYPQDIELTV
EKSHPALRVGCLAAFAVESKGSERLVVVAEVERTYLKKLNIQEVVNKIRQTVVTEHGLDV
FAVVLVKTGSIPKTSSGKIRRYVCRTAFLSGSLDVVQDWSESPESTKKYINLQAEIETIL
HKLQIETQG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgactctgagttatttaagagatagtgaatatagcgtctcaacgttagttgatgtactc
atttatcgagcaaagcaccagccagaacaaaaagcttatacatttttaaaaaatggagaa
caagaagcagatagtttgacttatcaagaacttcatctgcggtctagagcgatcgctggt
tctctgcaagctcttaatcttgttggagaacgggcgctactcttttatcaacctggatta
gattttattgctgccttctttggatgtttatatgctggagtagtagccgttcccgcctat
ccaccaagaaaaaatcaaaatctgagtagactacaggcaattacagctgatgcccaagct
caaatagtactcactacaaccacattactgaataaccgtgagctttttgctgaacaggag
ttagaactaggacagttgcaatggttaacaaccgatgtgttaactaatgaactcacacaa
tcatggcagcaactaaaacttgaagagaattccttagctttcttacaatacacttctggt
tctactgggaatcccaaaggtgtaatggtcagtcatggcaaccttttacataattctcgc
gcgatcgcccaatgttttggtcattcatccaacagcaaaggtttgatttggttacctcct
taccatgatatgggattgattggtggtattttacaacctctttacgctgggtttcccgtg
gtattgatgtcaccagtagactttttgcaaaaacccatacgttggttacaagcaatttct
cgctacaaagctactactagtggtggtccgaactttgcatatgagctatgcctgcgtaag
gccacacctgaacatttagaaagtctagacttaagtagttgggatcttgcttttacgggt
gccgaacccattcgtgctcaaacgttggagcaattcaccaaaacttttgcaccctgcggt
tttaatcaaaaagcattctatccatgctatggtatggcggaaacaactctgattgtttct
ggaggagaaaaaacagaattaccaatcctttgtaaagttgatcctgcagcactagaacaa
aatcgagtagtcaacgttatagatgaacagattgatgctagaaccttggtcgggtgtggg
caaagctgtcaagatatgagcattgttattgtcaatcccgagtctttaagtgtttgttcg
gagaaacaaattggcgaaatctggatatcaggttcaagtgtgactcaaggctactggaat
caagctgaactcacagagaaaaacttctatgcttatgcagatatgggagaaggtccattt
ttgcgtacaggagatttgggatttttacaagatgatgaactgtttgtcacaggtcggatt
aaagatatcatcattattcgtgggcaaaaccattatcctcaagatattgaactcactgta
gagaagagtcatcctgctttgagagtaggttgtttagctgccttcgcggtagaatccaaa
ggttctgaaagattggttgttgttgctgaagttgaaagaacttacttaaagaaattaaac
attcaagaagtcgtcaataagattagacaaacagtagtaacagaacatgggttagatgta
tttgctgtggtattggtgaagactggaagtattccaaaaacttctagtggtaaaattcgc
cgttacgtctgtcgaaccgcatttttgtcaggcagcttggatgttgtccaagactggagt
gaaagtccagaaagtactaaaaaatatatcaatttacaggcagaaattgaaactattttg
cataaattgcaaattgagacacaagggtag

DBGET integrated database retrieval system