KEGG   Nostoc punctiforme: Npun_F6084Help
Entry
Npun_F6084        CDS       T00713                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
npu  Nostoc punctiforme
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Npun_F6084
Enzymes [BR:npu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Npun_F6084
Transporters [BR:npu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Npun_F6084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
7525007..7525675
Genome map
AA seq 222 aa AA seqDB search
MVLTLYHSPISPNSRRVWITLLEKGLEFELVDIKLDGEQFQPEFLAINPFHHIPALVDDD
FNVVESLAILDYLEAKYPTPAMLPKDAKDLAIARMVQLVTVNELLPAATTFLPQILGLPG
ADPEKIEKAKHKIATVLKFFENLLDDRPYFASHNLTLAEVVAGTVVNVLPSVGIFLSEYP
KLNAWHDRLIVRPSWQATESTPEAMEAFKSVIVARNTRQTQT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaccctttatcattcgcctatttctcctaactcccgccgtgtttggattact
cttctggaaaaagggcttgaatttgaattagtagatataaagctggatggggaacagttt
caaccagagtttttggcaattaacccatttcatcacataccagctttggtggatgacgac
tttaatgtagtggaatctttagcaatcctggactatttagaggcaaaatatcctacacct
gcgatgttgcctaaagatgctaaggatttagcgatcgcacggatggtacaactggtaact
gtaaatgagcttttgccagcagcgacgacgtttttacctcagatattaggtttgcctgga
gcagatccagaaaaaatcgagaaggcaaagcataaaattgccacagtgctgaagtttttt
gaaaatttattagacgatcgcccttactttgctagtcacaacctcactctcgccgaagtt
gtggctggaactgtagtaaatgtgctgccaagtgttggcattttcttaagtgaatatcca
aaattaaatgcttggcacgatcgcttaattgtacgtccatcgtggcaagctaccgagtct
acaccagaggcaatggaagcgtttaagtctgtcattgtagcgagaaatacgcggcaaact
cagacctaa

DBGET integrated database retrieval system