KEGG   Nostoc punctiforme: Npun_R2355Help
Entry
Npun_R2355        CDS       T00713                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  
bicarbonate transport system permease protein
Organism
npu  Nostoc punctiforme
Pathway
ABC transporters
Module
Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:npu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Npun_R2355
Transporters [BR:npu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Npun_R2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2904823..2905662)
Genome map
AA seq 279 aa AA seqDB search
MTIAQKRPANPRLNNSFISGLQKQFPDLIPPAIAISIFLVLWQLFAWVPGATLPGPIQVI
QDTWVLIFWPFYDRGGIDKGLFWQILASLQRVAISYTLAAIVGIGLGVLIGVNKTMSKAL
DPIFQLLRTVPPLAWVPISLAALRQNEPAALFVIFITAIWPILINTAVGVTQIPQDYNNV
AKVLQLSRKEYFTNILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIWDAY
QNNNVSEVILALVYIGVVGLLLDKAMGWLQNKILPAEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagctcaaaaacgccctgcaaaccctagattgaataatagctttatttccggt
ctgcaaaagcaatttcctgacctgataccaccagcgatcgccatctcaattttcctcgtt
ctctggcaactcttcgcttgggttccgggagctacattaccaggcccaatacaagttatc
caagacacttgggttttgattttctggccattttatgaccgaggtggtattgataaaggt
ctgttttggcagattctcgctagtctgcaacgagttgccattagttataccctagctgca
atcgttggtattggcttgggtgttttgattggtgtcaataaaaccatgtccaaagcttta
gatcccatttttcaactactgcgaactgtaccacccctagcttgggtacctatttcttta
gcagctttaagacaaaacgaaccagctgccttattcgtaattttcattactgcaatttgg
cccatattaattaacactgctgtcggcgttacccaaattccccaagattacaacaacgtc
gccaaagttctgcaacttagccgcaaagaatatttcactaatattttgataccttcggca
ttaccatacatatttactggcttgagaattgcaatcggtctagcttggttagcaattatc
gccgcagaaatcgtcatgtccggtattgttggaatcggcttctttatctgggatgcctat
caaaataacaacgtcagcgaagtaattttagctctagtttatatcggcgttgttgggttg
ctcttagataaagcgatgggttggctgcaaaacaagattttaccagcagaacagaaatag

DBGET integrated database retrieval system