KEGG   Nostoc punctiforme: Npun_R6491Help
Entry
Npun_R6491        CDS       T00713                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
npu  Nostoc punctiforme
Brite
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Npun_R6491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(8014646..8015248)
Genome map
AA seq 200 aa AA seqDB search
MVFVQPPLPFDKNALEPNGMKAETFEYHYGKHHKAYVDNLNKLTEGTELADKPLEEVIKI
SFQDSSKAGIFNNAAQVWNHTFFWNSLKPNGGGAPTGDLAARIDKDFGSFDKFKEEFSNA
AATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDYRNARPAFI
KNFLDNLVNWDFAAENLAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggtatttgtacagcccccgctacccttcgacaagaatgctttagagccaaatggcatg
aaagctgaaactttcgagtatcactatggcaagcatcacaaagcttatgtagacaacctc
aacaagctcactgaaggtacagaacttgctgataagcctctggaagaggtgatcaaaatt
tccttccaagactcctctaaggcgggaatcttcaacaacgctgctcaagtttggaaccac
accttcttctggaattccttaaaaccaaatggtggcggcgcacccactggcgatcttgca
gccaggattgataaagattttggtagcttcgacaaattcaaggaagagttctctaacgca
gctgcaactcaatttggcagtgggtggtcttggctgattgatgatggtggtacgctgaag
gtgatcaaaacaccaaatgcagaaaaccctctagctcatggtaagaaggcactcctaacc
ttggatgtttgggaacatgcctactacattgactacagaaacgctcgtccagcgttcatc
aagaatttcctagataacttggttaactgggattttgctgctgaaaatttggctaaagct
taa

DBGET integrated database retrieval system