KEGG   Novosphingobium resinovorum: BES08_08785Help
Entry
BES08_08785       CDS       T04490                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nre  Novosphingobium resinovorum
Brite
Enzymes [BR:nre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     BES08_08785
Lipid biosynthesis proteins [BR:nre01004]
 Acyl-CoA synthetase
  Unknown
   BES08_08785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1888797..1890557
Genome map
AA seq 586 aa AA seqDB search
MADTIELVPNTGQALISTPNEDALPRIFADFATFGDALDYAATGKRGFNFHDPRGTLTRV
YPFSELREDALKVAYALIARGVKKDDRIALIAETGVDFAALFCGAVYAGAWPVPLPLPTS
FGGKDNYIDQLAVQLSSSDPILLIGPDEIATMTAAAAERQGCAHATWADFAAKDAPEVAL
PKADPDDICYLQYSSGSTRFPHGVAVTHRSLLSNLASHAHGMQFQDSDRCISWLPWYHDM
GLVGCFLSLIANQVSADYLKTEDFARRPLAWLDLITRNKGTSASYSPTFGYDICARRISS
QSPVSDRFDLSRWRIAGNGADMIRPDVMQSFVNAFADAGFKASAFLPSYGLAEATLAVTV
MPPGEGIRVELVEEERLSGAPRDLNRPARYRAIVNCGKAVRDMEVVIRGENGDTLGDHKI
GKVWCRGTSVMHSYFRDPEATAACLVDGWLDTGDMGYMTDGYLFIVGRAKDMIIINGKNH
WPQDIEWAVEQLPGFNHGDIAAFSVETDNGEEAPAVLVHCRVSDPVKRVELRDLIRDKVR
SITGMNCVVELVPPKSLPRTSSGKLSRAKAKKLYLSGEIEPFKLAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccatcgaactggtgccgaatacggggcaggcacttatctccacccccaac
gaggatgcgctgccgcgcattttcgccgatttcgccaccttcggcgacgccctggactat
gccgccacaggcaaacgcgggttcaatttccacgatccgcgcggcacgctcacgcgcgtc
taccccttctcggagctgcgtgaagacgcgctcaaggtcgcttatgcgctgatcgcgcgc
ggcgtgaagaaggacgatcgcatcgccctcatcgccgaaaccggcgtggacttcgcggcg
ctgttctgcggcgcggtctacgcgggcgcctggccggtgccgctgccgctgcccaccagc
ttcggcggcaaggacaactacatcgaccagctggccgtgcagctctccagctccgacccg
atcctgctgatcggtccggacgagatcgccacgatgaccgccgctgcggccgagcgtcag
ggctgtgcccatgccacctgggccgatttcgctgcgaaagatgcgcccgaagtcgcgctg
cccaaggccgatccggacgatatctgctacctgcagtattcctcgggctccacccgcttc
ccgcacggcgtcgcggtgactcaccgctcgctgttgtcgaaccttgccagccacgcgcac
ggcatgcagttccaggacagcgaccgctgcatctcgtggctgccgtggtatcacgacatg
ggcctcgtcggctgcttcctgtcgctgatcgccaaccaggtctccgccgattacctcaag
accgaggatttcgcgcgtcgcccgctggcatggctggacctcatcacccgcaacaagggc
acttcggcgtcctattcgccgacgttcggctacgacatctgcgcacgtcgcatctccagc
cagagcccggtcagcgatcgcttcgacctgtcgcgctggcgcatcgccggtaacggcgcg
gacatgatccgcccagacgtgatgcagagcttcgtcaacgccttcgccgatgcgggcttc
aaggcatccgcgttcctgcccagctacggcctggccgaagcgacgctggcggtcaccgtc
atgccgccgggcgaaggcatccgcgtcgaactggtcgaggaggagcgcctctcgggcgcg
ccgcgcgatctcaaccgcccggcccgctaccgcgccatcgtcaactgcggcaaggccgtg
cgcgacatggaagtggtgatccgcggcgaaaacggcgacacgctgggcgaccacaagatc
ggcaaggtctggtgccgcggcacgtcggtgatgcattcctacttccgcgaccccgaggcg
accgccgcgtgcctcgtcgacggatggctggacaccggcgacatgggctacatgacggac
ggctacctgttcatcgtcggccgcgccaaggacatgatcatcatcaacggcaagaaccac
tggccgcaggacatcgagtgggccgtggagcagcttcccggcttcaaccacggcgacatc
gcggcgttctctgtggagacggacaacggcgaggaagcccccgccgtgctcgtccactgc
cgcgtctccgatccggtcaagcgcgtcgaactgcgcgacctgatccgtgacaaggtgcgc
tcgatcaccggcatgaactgcgtggtcgaactggtgccgcccaagagcctgccgcgcacc
agctcgggcaagctcagccgcgcaaaggccaagaagctgtacctttcgggcgagatcgag
ccgttcaagctggcggcctga

DBGET integrated database retrieval system