KEGG   Novosphingobium resinovorum: BES08_27320Help
Entry
BES08_27320       CDS       T04490                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nre  Novosphingobium resinovorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pSA2:complement(485563..487044)
Genome map
AA seq 493 aa AA seqDB search
MTWTSADGAFSIAHPDRFYIGGEWVAPLSGRVFHHVDPATEEVQVDIAEATAEDIDRAVA
AARDAFDNGPWPRMTPRERAGYLVKLADLVRAGSVELGHAWTREMGIVHAVSQGGGAAFA
GYIDQHVRFAETFPWQETQPTTDGLGGEALLVREPVGVVGAIIPWNAAFILALVKMTPAL
LAGCTVVLKASPEAPLGPYVIMDMIDQIGLPPGVVNFVTADREASERLVRHPGVDKISFT
GSTAAGKRIGSLCAERVARFTLELGGKSAALVMDDYDVDKAATTLANSTAYMTNQVCAAL
SRVVVTDRNHDAMVEALKTRFDQIQVGDPYAEGSQMGPLAMSRQFDRVMDYIAIGQGEGR
MITGGSRPAELNRGYYVQPTIFTDVDPGARIAQEEIFGPVVVVLRAKDEQDAVRIANQSH
YGLDGAVFTNDREKAYSVGRQVRTGTFGQNLHRMDFGVSFGGFKQSGIGREGGFDGLKSF
CETKAIMLDPQLA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacctggacttctgcggacggtgcgttctccatcgctcaccccgatcgcttctacatc
ggcggcgagtgggtcgccccgctcagcggccgggtgttccaccacgtcgatcccgcgacc
gaggaagtgcaggtcgacatcgccgaggccaccgccgaggacatcgaccgcgccgtcgcc
gccgcgcgcgacgccttcgacaacggcccctggccgcgcatgacgcccagggaacgcgcg
ggctatctggtcaagctagccgatctcgtgcgcgccggatcggtcgaactcggccatgcc
tggacgcgcgagatgggcatcgtccatgccgtctcgcagggcggcggcgcggccttcgcc
gggtacatcgaccagcacgtgcgcttcgccgaaaccttcccctggcaggagacccagccc
accaccgacggccttggcggcgaggcgctgctggtgcgcgaaccggtgggcgtcgtcggc
gcgatcatcccgtggaacgcggccttcatcctcgcgttggtgaagatgaccccggcgctg
ctggcgggctgcacggttgtgctcaaagcttccccggaggcgccgctggggccttatgtc
atcatggacatgatcgaccagatcggcctgccgccgggcgtcgtcaacttcgtcaccgcc
gaccgcgaggcgtcggaacgtctggtgcgccatcccggcgtggacaagataagcttcacc
ggcagcacggcggcgggcaagcgcatcggctcgctctgcgccgagcgcgtggcgcgcttc
acgctggaactgggcggcaagtccgcggcgctggtgatggatgactacgacgtcgacaag
gcggctacgactcttgccaattcaaccgcttacatgaccaatcaggtctgcgccgcgctg
agccgcgtggtcgtgaccgaccgcaaccacgatgccatggtggaggcgctgaagacccgc
ttcgaccagatccaggtcggcgatccttatgccgaaggcagccagatgggcccgctcgca
atgtcccgccagttcgaccgggtgatggactacatcgccatcggacagggagaaggtcga
atgattacaggcggttcgcgcccggccgaactaaatcgaggctactatgtccagccgacg
atcttcaccgacgtcgaccccggtgcccgcatcgcgcaggaggaaatcttcggtcccgtc
gtcgtcgtgctgcgcgccaaggacgagcaagacgcggtgcgtatcgccaaccagagccac
tacggcctcgacggcgcggtgttcaccaacgaccgggaaaaggcctattcggtcgggcgt
caggtgcgcaccggaacgttcgggcagaacctgcaccggatggacttcggcgtctcgttc
ggcggcttcaagcagtccggaatcggccgcgaaggcgggttcgacgggctgaaatcgttc
tgcgagaccaaggcgatcatgctcgatccgcaactggcctga

DBGET integrated database retrieval system