KEGG   Nitratifractor salsuginis: Nitsa_1412Help
Entry
Nitsa_1412        CDS       T01405                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nsa  Nitratifractor salsuginis
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Nitsa_1412
Enzymes [BR:nsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Nitsa_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1411132..1412421
Genome map
AA seq 429 aa AA seqDB search
MNKKVYVGMSADLIHPGHMNIIKEASKLGEVIIGLLTDEAIASYKRLPYMNYEQRKEVLE
NIKGVSKVIPQETLDYRYNLRKIKPDYVVHGTDWREGVQAKVREQVIETLKEWGGELVEP
EYTKGISSTKLNQSLKEIGTTPDIRRARLRRLIKAKDTIRIMEVHNALSGLIVENIKVNN
IEFDGMWSSSLTDSTAKGKPDIEAVDITSRISTVNEIFEVTTKPMIFDADTGGIAEHFVF
TVRNLERIGVSAVIIEDKTGLKKNSLFGNEVTQTQDSIENFCHKINMGKRAQITDDFMII
ARIESLILEKGMDDAITRAKAYVEAGADGIMIHSRQKEPTEILEFCKIFRKEYNDIPIAV
VPTSYNQITATELSEAGVNIVIYANHMLRAAYPGMINVAKSILEHDRSLEAEKDLLSIKE
ILELIPGTK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaaaagtttatgtaggaatgagtgcagatctaattcatccggggcatatgaat
ataataaaagaagcatcaaagttaggagaagtaataataggtcttttaactgatgaggct
atagcaagctataaaagacttccttatatgaattatgaacaaagaaaagaagttttagaa
aacataaaaggagtttcaaaagttattccgcaagagactttagattatagatataattta
agaaaaataaaaccagactatgtggttcatggaacagattggagagaaggagttcaggca
aaggtaagagaacaagtcatagagactttaaaagaatggggaggtgaattagttgaacca
gaatatactaaaggaatttcatctacaaaattgaatcaatctttaaaagaaattggtact
actcctgatatacgaagggcaagacttagaagattaataaaagcaaaagacacaataagg
attatggaagttcataatgctttaagtggattgattgttgaaaatataaaagttaacaat
attgaatttgatggaatgtggagtagtagtttaacagattcaactgcaaaaggtaaacct
gatatagaagctgttgatattacaagtagaataagtacagtaaatgaaatatttgaagtt
acaacaaaacctatgatttttgatgccgacactggaggaattgccgaacattttgttttt
acagtaagaaatcttgaaaggattggtgtgagcgctgttataattgaagataagacaggt
ttaaaaaagaattctctttttggtaatgaagttacacaaactcaagatagtatagaaaat
ttttgtcataaaattaatatggggaaaagagcacaaattacagatgattttatgataatt
gcaagaattgaaagtttaattttggaaaaaggtatggatgatgctattactcgtgcaaaa
gcttatgttgaagctggtgcagatgggataatgatacattcaagacaaaaagaacctact
gaaattttagaattttgtaaaatttttagaaaagaatataatgatattcctattgctgtt
gtgccaacatcttataatcaaattacagctacagaattaagcgaagcgggagtcaacata
gttatttatgcaaaccatatgctaagagcagcatatccaggcatgattaatgtagctaaa
tctattttagaacatgatagaagtttagaagcggaaaaagatttgctttcaataaaagaa
attttagagcttataccgggtacgaaataa

DBGET integrated database retrieval system