KEGG   Nonlabens sediminis: BST91_09575Help
Entry
BST91_09575       CDS       T04875                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsd  Nonlabens sediminis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BST91_09575
   00020 Citrate cycle (TCA cycle)
    BST91_09575
   00620 Pyruvate metabolism
    BST91_09575
Enzymes [BR:nsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BST91_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2071176..2072828)
Genome map
AA seq 550 aa AA seqDB search
MAEIVNMPRLSDTMEEGVVAAWLKQVGDQVEEGDILAEIETDKATMEFESFQSGTLLHIG
VQEGETAPVDSLLCIIGEEGEDIQALLDGAGDSSNTENEDSSNTQDSNEDKNDEPSSSTD
DSNDLPDGVEIITMPRLSDTMEEGTVASWLKKEGDQVEEGDILAEIETDKATMEFESFHS
GTLLKIGIQEGETAAVDALLAIIGPEGTDVSNVSLDGTSNSSTKKEEKKEAPAKEEPKSQ
PKKQEPKKEETKTVSNSSNSTSSSNTGRVFASPLAKKMAQDKGIDLSQVQGSGENGRIIK
KDIESFTPGTSTGVSQPAFEAVGEETFVEMANSQMRKTIAKRLSQSKFTAPHYYLGIELD
MDNAIASRKAINELPDTKVSFNDMVIKAAAMALRKHPQVNTQWTDKNTIQAKHIHVGVAV
AVDDGLLVPVLPFADQMSMQQIGAKVKELAVKARNKKLQPKEMEGSTFTISNLGMFGITE
FTSIINQPNSAIMSVGTIVQKPVVKNGQIVVGNTMKITLACDHRTVDGATGAAFLQTFKQ
YMENPIVMYV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattgtaaacatgcctagattaagcgacaccatggaagaaggtgtcgtggca
gcgtggcttaagcaagtaggtgatcaagttgaagaaggtgatattcttgcagaaattgaa
acagacaaggctaccatggaatttgaatcatttcaaagtggtactttattacacataggt
gttcaagaaggtgaaaccgcacctgttgattcgcttttatgtataatcggtgaagaaggt
gaggatattcaagctttactagatggcgctggggattcatccaatacagaaaacgaagat
tcttctaatactcaagattcaaatgaagataagaacgatgaaccttcatcttcaactgat
gattctaatgatttacctgatggagtggaaatcattactatgccgcgattgagtgatacc
atggaagaaggtacagttgcaagctggttgaaaaaagaaggtgatcaagttgaagaaggt
gatatccttgcagaaattgaaacagataaggctaccatggagtttgagtcatttcatagt
ggaactcttcttaaaattggtatacaagaaggagaaactgctgctgtagacgctttgtta
gctatcattggtcctgaagggacagatgtttccaatgtatccttagatggaacttctaat
tcttcaacaaagaaggaagagaaaaaagaagcgccggccaaagaagaaccaaaatctcaa
ccaaaaaagcaagagcctaagaaggaagaaacaaagactgtttctaattcaagtaactca
acttctagtagtaatacaggccgtgtttttgcatcaccactagcaaagaagatggctcag
gataaaggaatcgacttgtcgcaggttcaaggttctggagaaaatggtcgtatcattaaa
aaggatatagaaagttttactcctggaacttctacaggtgtctctcaacctgcttttgaa
gctgttggagaagagacatttgttgaaatggcaaattctcaaatgcgcaagaccattgca
aaacgtttgagccaatccaaatttacagcaccacactattatctaggaattgaactagat
atggataatgctattgcaagtagaaaggcaatcaatgagttgccagatactaaggtgagt
tttaatgatatggttattaaagcagctgcaatggcattgagaaaacatccacaggtgaat
actcaatggacagataaaaacaccatacaggcgaagcatattcacgtaggagttgctgtt
gccgttgatgatggtttactggttccagtgttaccgtttgcagatcaaatgagtatgcaa
caaataggtgcaaaagtaaaagagctagctgttaaagcccgtaataaaaagttacaacct
aaggaaatggaaggtagtacttttactatttcaaatcttggaatgtttggtattactgaa
tttacttctataatcaatcagcctaacagtgcaatcatgtcagtaggtactatcgttcaa
aaaccagtggttaagaacggtcagattgtagttggtaatactatgaaaatcactttagct
tgtgatcaccgtacagttgatggtgcaacgggagctgcattcttacaaacatttaaacaa
tacatggaaaaccctatcgttatgtacgtatag

DBGET integrated database retrieval system