KEGG   Neisseria sicca: A6J88_12580Help
Entry
A6J88_12580       CDS       T04958                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nsi  Neisseria sicca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6J88_12580
  Amino acid metabolism
   00310 Lysine degradation
    A6J88_12580
   00380 Tryptophan metabolism
    A6J88_12580
Enzymes [BR:nsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A6J88_12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2544864..2547692)
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYENFLENPNSVDEKWKQYFTDLSKQPGAADVDIAHAPI
RESFANLAKTKSTAAIAGGMDEAMMKKQVGVLRLISAYRIQGVGAAQLDPLKRIPPRNIE
ALDPKFHGLNDADMAVQFNMGEGDFSGQSKLPLSQIISNLKQTYCGHLALEYIYIPNTEE
RRWLRNYFEDVLSTPSYSAEQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESVIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPNGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFVGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDTRDTRSTVHCTDVAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFNKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQAEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREDVETGLPAADIERLAEKFTAVPEGFALHPTAKRVLEARKGMAAGSQPIDWGMAE
TLAYASLVTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRNMGEGAGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSGRVERWLQLCSEHNMQIIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSRFRPVIGDTAERGNNESVKRVILCAGQVYYDLEAG
RAERKLENDVAIVRVEQLYPFPYDEVRAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRLE
DVIGESQKLSYAGRPSSASPAVGYMSKHVAQLKQLVEDAMTL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgaaaaactcaatttttcttatctgttcggttcaaatgctccctacatcgag
gagttgtatgagaatttcctggaaaaccccaattcggtcgatgaaaaatggaagcagtat
ttcaccgacttaagcaagcagcctggtgcggcggatgttgatatcgcccatgctccgatc
cgtgaatccttcgctaatttggcaaaaaccaaatcgacagcggctattgccggcggtatg
gatgaagccatgatgaagaaacaggtcggtgtattgcggttgatttctgcttaccgtatt
caaggtgtgggtgctgcccagcttgacccgctcaaacgtatcccgccacgcaacattgaa
gccctcgatcccaaattccacggactgaatgatgccgatatggcggttcagttcaatatg
ggcgagggcgatttttccggccaaagcaagctgcctctgtcccaaatcatcagcaacctc
aaacaaacctactgcggtcacctcgcattggaatacatctacattcccaatacagaagaa
cgccgctggttgcgcaattattttgaggatgtgctgtccaccccgagttacagcgccgaa
cagaaacgccgcatcctgaaagaaatgaccgctgccgagactttggagcgttacctgcat
accaaatatgtcggtcagaaacgcttcggcgtagaaggcggcgagagcgtgattgccggt
ctgaattacctgattcaaaacgcaggtaaagacggcgtcgaagaagtcatcatcggtatg
gcacaccgaggtcgtctgaatgtcttggtcaacattttgggcaagaaaccgggcgatttg
tttgccgaatttgaaggccgtgccgaaatcaagctgcccagcggcgacgtaaaataccac
atgggtttcagctccgacatcgctacgccgaacggtccgatgcacgtttctttggcgttc
aatccgtcgcatttggaaatcgtgaatcctgtcgttgaaggttctgcacgcgccaaacaa
aaacgcctgggcgaaaacggccgcgacaaagtattgcccgtattgattcacggcgactct
gcatttgtcggactgggtgtcaaccaagcaacgttcaacctgtccaaaacgcgcggctac
accaccggcggtacggtccacatcgtcatcaacaaccaaatcggctttaccacctccgat
acccgcgacacccgttcgaccgtgcattgtaccgacgtggcgaaaatggtttccgctccg
gtcatccatgtcaacggcgacgatccggaacgcgtttgcttcgccatccaagccgctttg
gactaccgtaagaaattcaacaaagacatcgtgatcgatgtcgtctgctaccgcaaatgg
ggccacaacgagggcgacgatccgaccctgacccagccgatgatgtacaaaaaagtatcg
caacaccccggtgcgcgtgctttgtacactgagcaactgattgcagaaggcgtggtaacg
caggcagaagccgacggctatatccaagcctaccgcgatgctttggacaaaggcgaacat
gtcgagcaaacgacgttgagcaacttccaacgtacgcaaatcgactggagcaaataccaa
ggtaaagactggcgcgaagatgtggaaaccggcctgcccgctgccgacatcgagcgtctt
gccgagaaatttaccgccgttcccgaaggctttgcactgcatccgactgccaaacgcgtg
ctcgaagcgcgcaaaggcatggctgcgggcagtcagccgattgactggggtatggcggaa
accctcgcatacgccagcctggtcaccaaaggccacggcgtgcgcatttccggcgaagac
tccggacgcggtacgttctcacaccgccatgccgtattgcacgaccaaaaacgcgaaaaa
tgggatgacggcacttatgtaccgctgcgcaatatgggcgaaggcgcaggcgaattcctc
gtcattgactccatcttgaatgaagaagcggtcatggcgttcgaatacggttttgcctgc
tccgcgcccgacaaactgaccatttgggaagcgcagttcggcgactttgccaacggcgcg
caagtgaccatcgaccaattcctgtcgtccggcgaaaccaaatggggccgtctctgcggt
ctgaccaccatcctgccgcacggttacgacggtcagggcccggaacactcatccggccgc
gtagaacgctggttgcaattgtgttccgaacacaatatgcaaatcatcatgccgtccgaa
gcgtcgcaaatgttccacctgctgcaacgccaagtcttgggttcgtaccgcaaaccgctg
gtgattttcatgtccaaacgcctgttgcgcttcaaaggcgcgatgagtccgctggaaaac
tttaccgaaggttcgcgcttccgtcccgtcatcggcgataccgccgagcgtggcaacaat
gaaagcgtgaaacgcgtgattctgtgtgccggacaggtttactacgatttggaagcaggc
cgtgccgagcgcaaactggaaaacgatgtcgccatcgtccgcgtcgagcagctttatccg
ttcccatacgacgaggtgcgtgcagagttggcgaaatatccgaacgcgaaatccgtggtt
tgggcacaagaagagccgaaaaaccaaggtgcgttctaccaaatccgccaccgcttggaa
gacgttatcggcgaaagccaaaaactgtcttatgccggtcgtccgagcagcgcatcgcca
gccgtcggctatatgagcaaacacgtcgcccagctgaaacaactggttgaagacgcaatg
acgctgtaa

DBGET integrated database retrieval system