KEGG   Nocardia soli: BOX37_00425Help
Entry
BOX37_00425       CDS       T04582                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nsl  Nocardia soli
Brite
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BOX37_00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APE37897
UniProt: A0A1J0W108
LinkDB All DBs
Position
complement(88782..89402)
Genome map
AA seq 206 aa AA seqDB search
MAEYTLPDLDYDYSALEPHISGQINEIHHSKHHAAYVAGANAALEKLEAARETGDHAAIF
LNEKNLAFHLGGHTNHSIWWKNLSPNGGDKPEGDLAAAIDDQFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGQNLLTFQLYDQQANVPIGIIPLLQVDMWEHAFYLQYKNVKADYVTA
FWNVVNWADVQDRFARAVSQGKGLIF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagtacacgctgccggatctggattacgactacagcgcattggagccccacatc
tcggggcagatcaacgagatccaccactccaagcaccacgccgcctacgtcgcgggcgcc
aacgccgcactggagaagctggaagccgcccgtgagaccggcgaccatgccgccatcttc
ctcaacgagaagaacctggccttccacctgggtggccacaccaaccactcgatctggtgg
aagaacctctcccccaacggtggcgacaagcccgaaggcgacctcgccgccgcgatcgac
gaccagttcggttcgttcgacaagttccgcgcgcagttcaccgcggccgccaacggcctg
cagggctccggctgggccgtcctgggttacgacaccctgggccagaacctgctgaccttc
cagctgtacgaccagcaggccaacgtgccgatcggcatcatcccgctgctgcaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaccgcg
ttctggaacgtcgtcaactgggccgacgtgcaggaccgcttcgcccgcgcagtctcgcag
ggcaagggcctgatcttctga

DBGET integrated database retrieval system