KEGG   Nocardia soli: BOX37_06750Help
Entry
BOX37_06750       CDS       T04582                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
nsl  Nocardia soli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: APE33716
UniProt: A0A1J0VNV0
LinkDB All DBs
Position
complement(1504388..1505347)
Genome map
AA seq 319 aa AA seqDB search
MAKSATPAVELPVGEHTVRVSNPDRVYFPELGATKLDLVRYYLSVGDGIVNALRDRPCML
HRFPKGLPGGKVHQKRLPAGAPDWIRTVRVYFPRYGRHADELCVHELADVIWAVQMSTVE
FHPWNSRARDTESPDEWRIDLDPMPDCPWSRVQRVAAVVHEVLDELGATGWPKTSGGSGL
HVYVRIAPEYGFTQVRRAALAFAEEVRRRAPEDVTTAWWRRDRDPAQLFVDYNQNARDHT
IAAAYSVRGVAAATVSTPVRWSEIDDIHPRDFTIATVPARYAELGDLQADMDEAVFDITP
LLELADRHGVDEPVDLDES
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagtctgcgactccggctgtcgaactgccggtgggtgagcacacggtgcgggtc
agcaatccggaccgggtgtattttcccgaactcggcgcgacgaagctcgatctggtgcgc
tattacctgagcgtgggtgacggcatcgtcaacgcgctgcgggaccggccgtgcatgctg
caccggtttccgaagggcctgcccggcggcaaggtccaccagaagcggctgcccgcgggc
gcgccggactggatacgcaccgtccgcgtgtacttcccgcgctacggccgccacgccgac
gaactgtgcgtgcacgaactcgccgacgtgatctgggcggtgcagatgtcgaccgtcgaa
ttccatccgtggaactcccgggcccgcgacaccgaatcgcccgacgagtggcgcatcgac
ctcgaccccatgccggactgtccgtggtcgcgggtgcagcgagtcgccgcagtggtgcac
gaggtgctcgacgagctcggcgcgaccgggtggcccaagacctccggcgggtccggcctg
cacgtctacgtgcggatcgcaccggagtacgggttcacgcaggtgcgccgggccgcgctc
gccttcgccgaggaggtacggcggcgggcgcccgaggacgtgaccaccgcatggtggcgc
cgcgaccgagatccggcgcagttgttcgtcgactacaaccagaacgcgcgcgatcacacc
atcgccgccgcctattccgtgcgcggggtggccgcggcgacggtgtcgaccccggtgcgc
tggagcgagatcgacgacatccacccgcgcgatttcaccatcgccaccgtgcccgcccgc
tacgccgaactcggtgacctgcaggccgacatggacgaggccgtcttcgacatcacgccg
ctgctggaactggccgatcggcacggcgtcgacgaaccggtcgacctcgacgaatcgtga

DBGET integrated database retrieval system