KEGG   Nocardia soli: BOX37_09960Help
Entry
BOX37_09960       CDS       T04582                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nsl  Nocardia soli
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOX37_09960
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BOX37_09960
   00680 Methane metabolism
    BOX37_09960
Enzymes [BR:nsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BOX37_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2222244..2225015
Genome map
AA seq 923 aa AA seqDB search
MGESRIETEQEATRPLREDIRFLGGILGDTLRDHEGREVFDLVERVRTEAFRVRREEVER
SAVADMLDGTPTEVAIPLIRAFSYFVLLANLAEDLQRDRRRAVHVAAGEPPQDSSLAATY
DKLDAAAIDGATVAELLTDALVSPVITAHPTETRRRTVFDVQAKITELMRLRRRLAPGEP
GYDESELRIRREVLTLWRTALIRLARLRIQDEISVGLRYYDLTLYDVIPAINAQVRAALR
VRWPEVDLLARPILRPGSWIGGDRDGNPFVTAEVVHTAAEQAAAYAFGRYLRELVELEKT
LSQSARLVQVTPAVAALAEAGYPDPAFFADEPYRRALHAIRARLSATAQRSLGELPEHGL
DAGAAPYPTPQAVLDDLDAIDVSMRASGDALLADDRLAALRHAIETFGFHLQGLDMRQNS
EVHEQVVTELLAWSGVHADYPSLSEAERVELLAAELRTRRPLLGPNAQLSELTVKELGVL
CAAKEVIDTFGAAAIPNYIISMCTSVSDMLEAALLLKEAGILDPGSADNQPSCPVGIVPL
FETIEDLGAGASTLAAVLEVPVYRELVATAGMRQEVMLGYSDSNKDGGYLAANWALYRAE
LDLVEVAGKSGIRLRLFHGRGGTVGRGGGRSYDAILAQPAGAVRGSLRLTEQGEVIAAKY
SERGAAQRNLESLIAGTLESTLLDVEGLGEDAEPAYELLDDLAARARAAYARLVHETPGF
VEYFRQSTPVAEVGDLNIGSRPASRKPTNSVSDLRAIPWVMAWSQARVMLPGWYGTGTAL
EEWVGDDPERLARLTDLYQRWPFFRTVLSNLAQVMAKSDLDIAARYADLVTDEALRAQIF
GMIGDEHARTIRMYLAVTGHAGLLSDNPSLAESIHNRFPYLEPLNQLQVDLLRRLRGGDD
SELVKRGILLTMNGLATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatcgcgaatcgagaccgaacaggaagccacccggccgctgcgcgaggacatc
cggtttctcggcggcatcctgggcgacaccctgcgcgaccacgaaggtcgcgaggtgttc
gatctggtcgagcgggtgcggaccgaggcattccgggtgcgccgcgaggaggtcgagcgc
agcgcggtcgccgacatgctcgacggcacgcccaccgaggtcgcgattccgctgatccgg
gcgttcagctacttcgtgctgctggccaacctggccgaggacctccagcgcgaccggcgc
cgcgccgtgcacgtggcggcgggggaaccgccgcaggactcctcgctggccgccacctac
gacaagctcgacgccgcggccatcgacggcgcgacagtggcagagctgctcaccgacgcg
ctcgtctccccggtcatcaccgcccaccccaccgagacccgcaggcgcaccgtcttcgac
gtgcaggccaagatcaccgagctgatgcgcctgcgccgccgcctcgcgcccggcgagccc
ggctacgacgaatcggaactgcggattcgccgtgaagtgctcaccctgtggcgcacggcg
ctgatccggttggcgcgcttgcggatccaggacgagatctcggtgggcctgcgctactac
gacctcaccctctacgacgtgatcccggccatcaacgcccaggttcgcgccgccctgcgt
gtccgctggcccgaggtcgacctgctggcgcgcccgatcctgcgccctggctcctggatc
ggcggcgaccgcgacggaaatccctttgtcactgccgaagtcgtgcacaccgcggccgag
caggccgccgcctacgccttcggccggtatctgcgtgagctggtcgaactggagaagacg
ctgtcgcagtcggcccgcctggtccaggtgacgcccgcggtggccgcgctcgccgaggcg
gggtatcccgatccggcgttcttcgccgacgaaccctatcgccgcgcgctgcacgcgatc
cgggcgcgcctgagcgccaccgcgcagcggtcgctgggcgagctgcccgagcacggtctc
gacgccggggccgcgccgtaccccaccccgcaggcagtgctcgacgacctcgacgcgatc
gatgtgtcgatgcgcgccagcggcgacgccctgctcgccgacgaccgcctcgccgccctg
cgccacgccatcgagaccttcggtttccacctgcagggtctggacatgcggcagaactcg
gaggtgcacgagcaggtcgtcaccgaactgctggcctggtcgggcgtgcacgcggactat
ccgagcctgtccgaggccgagcgcgtcgagttgctcgccgccgaattgcggacgcgccga
ccacttctgggcccgaacgcccagctgagcgagctcaccgtcaaggagctgggggtgctg
tgcgccgccaaggaggtgatcgacaccttcggcgccgccgcgatcccgaactacatcatc
agcatgtgcacctcggtcagcgacatgctcgaggccgcgctgctgctgaaagaggcgggc
atcctcgacccgggttcggccgacaaccagccgagctgccccgtcgggatcgtgccgctg
ttcgagaccatcgaggacctcggcgcgggcgcgtcgaccctggccgcggtgctcgaggtg
ccggtgtaccgcgaactcgtcgcgaccgcggggatgcggcaggaggtgatgctcggctac
tccgattccaacaaggacggcgggtatctggccgcgaactgggcgctctaccgcgcggaa
ctggacctggtggaggtggcaggcaagtcgggcatccggctgcggctgttccacggtcgc
ggcggcaccgtcggtcgtggcggcggacgcagttacgacgccatcctcgcccagcccgcc
ggtgcggtgcgcggttcgctgcggctcaccgagcagggtgaggtgatcgccgccaagtac
tccgaacgcggtgcggcacaacgcaatctggagtcactgatcgccggcaccctcgaatcg
accctgctggacgtggagggtctgggcgaggacgccgaaccggcctacgaactgctcgac
gatctggccgcccgcgctcgcgccgcctacgcgcgcctggtgcacgagactcccggcttc
gtcgagtatttccgccagtccacgccggtcgccgaggtcggcgatctcaacatcggtagc
cgccccgcctcgcgcaaacccacgaattcggtctcggatctgcgcgccatcccgtgggtg
atggcgtggagtcaggcccgggtgatgctgcccggctggtacggcaccggcaccgcgctc
gaggaatgggtgggcgatgaccccgaacgcctggcccgcctcaccgatctctaccagcgc
tggccgttcttccggacggtgctgtccaacctggcgcaggtgatggccaagagcgatctc
gacatcgccgcccgctacgccgacctggtcaccgacgaagccctgcgcgcgcagatcttc
ggcatgatcggcgacgaacacgcccgcaccatccgcatgtacctggcggtcaccgggcac
gccggcctgctcagcgacaacccgtcgctggcggagtcgatccacaaccgcttcccctac
ctggagccgctgaatcagctccaggtggacctgctgcgcaggctgcgcggcggtgacgat
tccgaactggtgaagcgtggcatcctgctcaccatgaacggcctggccaccgccctgcgc
aactcgggttag

DBGET integrated database retrieval system