KEGG   Nocardia soli: BOX37_14570Help
Entry
BOX37_14570       CDS       T04582                                 

Definition
(GenBank) hypothetical protein
Organism
nsl  Nocardia soli
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3285352..3295719
Genome map
AA seq 3455 aa AA seqDB search
MGAVSGFHGQRKQFVLNTFVETLFARVENRSAEVVYRFLDNGDVDGVVRELTYAQLGRRA
RAIGAVLQDSAPRRALLLFPAGPEFAEAFFGCLAAGVVAVPAPLPEWDNRSLRRLRRMVA
HAEVDVVLAPRRVVAESAALSAEIPELAGLPWLATDELPDAAALRWQEPDLSSDSVAFIQ
YTSGSTSAPRGVVLTHGNLLHNQEALAAGLGHDRALAESWDGALFASWLPMYHDMGLIAP
LLHTVYLGANSVLMSPLHFLQRPERWLQAISTYGAHTSGGPNFGYELCLRRVTPEQIDQL
DLSRWRVAFNGSEPVRAATVRRFADTFARAGFRAEAQQPVYGLAEATLIVTAPPTTAPPT
IVPGISAHGRELVGVGPAAAGMSLAIVDPGSGLARADGEEGEIWVAGDSVAAGYFRDEQS
SAEVFGAMLPGDDRRFLRTGDLGFVSSGELFVTGRHKDLVIVDGRNHYPQDIEATVEAAH
AEVRAGCVAAFAVEAGADGEQPVVVAEVRGSDPDELAAAEGAIRAAVSSEHGLTLAAVLL
IRPGTVFKTSSGKIQRSACRAAYLSGELLALLAGPMRSPEDEFEEPAAEVAVEEPAAELS
VEAVRSWLVHAIARQALLDPERVDIHRPLVEFGLGSADLVELVVDLSDFVGRFIDTNLFF
DHPTIAGVATVLAGPAESDTAAPEAVEPESRADAEDDDAVAIIAMSCRFPGAADSPEALW
RLLDGETDGLSEVPPGRWDIDGLYDPDATMPGTAYTFRGGYVDGIDRFDAAFFGIGPREA
AVMDPQQRMMLQLAWEAIERSGRDPRTLHGSATGVYLGVYSTGYLADPAPDQLNGQVGTG
LSPSVASGRISYTLGLHGPAVTLDTACSSSIVAMHLAMQALRAGECELALAGGATLLMSP
IAHIELCKLGVLSPTGRCAPFSADADGTVWAEGAGLVLLKRLSDARRDGDRVLAVVRGSA
VNQDGRSQGLSAPNGAAQEQVLRSALRASGLAPHEIDYVEAHGTGTALGDPIEARALARV
FGPGRDPARPLGVGSLKSHVGHTQAAAGVASVIKLVLALQHERIPATLNAAQPSPHVDWA
RSGVAVQAQAGPWQRGDRPRRAGVSAFGLSGTNAHLILEEAPPTPVEEADPLAGGVALLP
ISARSEASVHGQARRLLDLVAADPRSDPGQVSRALALQRSQFERRAVVVAADRAGMVGAL
GDLVAGRSSADVAVGTGPVLTNAKTAFVFPGQGMQWVGMAGDLLSSSAEFRAEFELCDKA
FGAHIGWSLVDRLTTMAPADLVDFPVVQPLLFATMAALAATWRAAGVTPDAVLGHSQGEI
AAAYCAGVLDLDDAARIVVTRSRLMQAIDEPAAMAMIGLPEAEVATRLLAFDGRVSIAAV
NVRRSTIVAGEQAAVTELLAELDRAGIYTRLGASGPGLAGHCGLIEVIREPLTDQLADLG
ASAPTIAWYSTVTGELVTDAPAGPEYWYRNARETVRFAATVERLIADGFRYFVELGMHPS
LTAAVKTVSEELERDVIAVGSLVRDEDGPTSLARAQAALYVGGHDLDWSRLAPERGRIDL
PTYAFDERSFWTEGANRDTGSLGLDDITHPVLGAAVPQPDSDGVTLTGRISRAKQPWVVD
HAGPHAVLVPGAALVEWAVRAGDEVDCPVVRELVLRAPLLVPEQGSVQVQVVVGGADQDH
RRTVRIFARSETDPDAQWTLHADGILGEELDHSLAQRDSFRSPPPAAGPGPAATVGRNPA
AAMDAPDHTAVIGAPHRAAGTALSGVGWSVGPRSGSPDFDLPHDGAHHPGGAGDSVTSAP
ARSWPPTGATRVDVDDLYQRLFARGHHYGPLFRAMRTAWRRDDEIFVEVELAESAHGAAA
DFGIHPALLDAALHATALFAADDGGHALLPFVWSDVALWATGATTLRVRLARSGTDTVTM
SATDRTGRPVVSVGSLLLRPVDPTQWQSATLAPAHRRLFQVKWTPLPLSPVHGVRSLGDW
HDTEPGATDAVILTVPEGNSTVEVHDTAQYVLGALQSFLGDNRFETATLIVRTQAVVPVA
SSGLAAVRGVVASRDTAGTPGVRVVGGVVDAGTDYVGARVSSGGTGPDPVGAVVWGLVRS
AQSENPGRIVLVDSADADVDFAAVLATGEQQVAVLEGLAFAPRLARLPEGPTPAGRVSLG
DGAVLVTGAPGRLGSALARHLADAYGVRDLVLVSRRGVDGPGGAELRDDLEQRGVRVRFA
ACDITERPALAELLDGLPLAGVIHAACVLDDATIGSLTPDQLTAVLRPKVDAAQHLHELT
ADRDLSIFVLFSAAGGLFGTPGQANYAAANAYLDALAVHRRSLGLPAQSLAWGAWDVDMH
EHMADADIRRIARAGVRAFSVPDGMACFDAALAQGDPLLVPLLLDTEVLRRSPAVPPLLR
GLVRRAPRRAVADHAAVDPATGSAFARELRALPRAEAITVVTAAVAGWTGEVLGHSGTAT
VAVEETFQSLGLDSLMAVELRNKVRAHTGIAVPLGTILAEQNLTDLAAYLVEEVVRQDSR
SAETAAVEVPEVEVLPVTRDMMRLLRTEQLGIPSAAQTGGVAVRLRTRVTRAELEQAVAR
SARRHAAMRTAVRASDANGRQLEIYREAALSIGWRSLDHLDDVVVEARFRDLMAPAFDVA
TGPLWRFELLDAESTDQVLLVGAHHAMSDVQSMLLVAGELVAELSGIRLDDTVTNRDLHQ
LLAAQPARRDDNAVARWRAAFAGAQRLELTLARSRPAERGYGAGALALDMPPGLHDRVAD
RARELGITPAAVFLGALTVTLARRQQIDRFAVAVPVDTRMHADATDAVGYFGVPVPFPAA
VETGDLVADVLRRTGDRLRNLLAPGAGFAEVIAALAGEGLARDNAPLVEVYFNYLRANSA
VGRAEIVPVSTGYSDLDLMIAVLPDTGQVWFTYNTDIIDARTCTAFGTDYLAVVEAAVAD
PGAPVGAEAVGPEAVSGVRAAVAATFALGRLPELLVAASSENALSVAEAPYHHVLACLRD
PSGVFAQPSTTLGVLLMRAADLERFGEVTDEVLAELAVEFPTVIKGVVERTGRSIIVGIA
PTRRSTERLIEWERTVVENLRDVPGIAVLEAEQWTRLHAVADPYDERTEVLAHLPFTPEF
QAAMALTLTATVTAVVEPAPKVIAVDGDDTLWSGIAGEIGVTGVEFDAPRRLLARRLRQW
RAAGTLLVLVSNNDEDIVRAILDRPDSPLSPAAFAAISASWDGKPDRVENIARTLGLGLD
TFCFLDDNPVEVARMRAQLPEVLCDLPARRGARIVPHPPVATGTARRDHRGPPARRLLSP
GIRPRPCPCRTGIRGVPRSTGTRGRHRATDRGHHDPGTTTRAPHHPVHPRHRHRRRPRPV
ARARRGLDGHRPRPLRRLRPDLGTRPAERGRRSPDHRLATQLPSPRPRRRRTTPPMGGRP
RRRPRLRDGPPVGRPHAPQRTGPPPGRPPARQLDQ
NT seq 10368 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcagtcagcgggttccacggtcagaggaagcagttcgtgctcaacactttcgtc
gagacattgttcgcccgggtcgagaatcggtcggccgaggtggtctatcgattcttggac
aatggagacgtcgatggtgtcgttcgcgaattgacctacgcccagctgggccgccgcgcc
agggcgatcggcgccgtcctgcaggactccgcgccgcgccgggcgctgttgctcttcccc
gccggtcccgagttcgccgaggcgttcttcgggtgcttggccgcgggggttgtcgccgtg
ccggcgccgctgcccgaatgggacaaccgctcgctgcggcgattgcggcggatggtcgcc
catgccgaggtcgacgtggtgctggcgccgcgccgggtggtcgcggagtcggcggcgctg
agcgcggagatccccgaactggcgggactgccctggctggccaccgacgagctacccgat
gccgccgcgctgcgctggcaggaaccggatctgtcgtcggactcggtggcgttcatccag
tacacctccggttcgaccagcgccccgcgcggcgtcgtgctgacccacggcaatctcctg
cacaaccaggaggcgctcgccgccggtctcgggcacgatcgcgcactggccgaatcctgg
gacggcgccctgttcgcgagctggctgccgatgtatcacgatatgggtctgatcgccccg
ctgttgcacacggtgtatctcggcgcgaattcggtgctgatgtcgccgttgcatttcctg
cagcggcccgaacgctggctgcaggcaatttccacttacggcgcgcacaccagcggcgga
ccgaatttcggctatgaactgtgtcttcgccgcgtcaccccggaacagatcgatcagctc
gatctgagccgatggcgggtggcgttcaacgggtcggaaccggtcagggccgcgacggtg
cggcgtttcgccgacaccttcgcccgcgccggcttccgcgccgaggcccagcagccggtc
tacgggttggccgaggcgacattgatcgtcaccgcaccgcccaccaccgcgcccccgacg
atcgtgccggggatctccgcgcacggcagggagctcgtcggcgtcggcccggcggcggcc
gggatgtcgctcgcgatcgtcgatccggggagcggcctcgcccgcgccgatggcgaggaa
ggcgagatctgggtcgccggcgacagcgtggcggcggggtacttccgcgacgagcagtcg
agcgccgaggtgttcggggcgatgctgcccggcgacgaccgtcgcttcctgcgcaccggt
gacctcggattcgtctccagtggtgagcttttcgtgaccggtcggcacaaggacctggtc
atcgtggatggtcgcaaccactatccgcaagacatcgaggcgaccgtcgaggcggcgcac
gccgaggtgcgcgcgggctgtgtggcggccttcgccgtcgaggccggtgccgacggtgaa
cagccggttgtggtggccgaggtgcgtgggtccgatcccgacgagctggccgccgccgag
ggggcgatccgggccgcggtgtcgagcgagcacgggctcaccctcgccgcggtgctgttg
atccggccggggaccgtgttcaagaccagcagtggcaagatccagcgttcggcgtgccgg
gcggcgtatctgtccggtgagctgctggcgttgctggcggggccgatgcgctcgcccgag
gacgagttcgaggagcctgcggcggaggtcgcggtcgaggagcccgcggcggagttgtcc
gtggaggccgtgcgatcgtggctggtgcacgcgatcgcgcggcaggcgctgctcgatccc
gaacgggtcgacatccaccgtcccctggtcgaattcggtttgggctcggccgatctggtg
gagctcgtggtcgatctgtcggacttcgtcggccggttcatcgacacgaatctgttcttc
gaccacccgacgatcgccggggtggccacggtgctggccgggccggccgagagcgacacc
gccgcacctgaagccgtcgaacccgaatcacgggcggacgccgaggacgacgatgccgtc
gcgatcatcgccatgtcctgtcgattccccggtgccgcggattccccggaagcgctgtgg
cgtctcctggacggcgagaccgacgggttgtcagaggtgccgccgggccgctgggacatc
gacggtctctacgacccggacgcgaccatgcccggcacggcctacaccttccggggcggt
tacgtcgacgggatcgaccgcttcgacgccgccttcttcggcatcggcccccgcgaagcc
gcggtgatggacccccagcaacggatgatgctgcagctggcctgggaggccatcgagcgg
tccggccgcgacccgcgcaccctgcacgggagcgcgaccggggtgtacctgggcgtgtac
agcaccggctatctggctgatcctgcgcccgaccagctgaacggtcaagtgggaaccgga
ctttcgccgagcgtcgcgtccggtcgcatctcctacaccctgggtctgcacggacccgcg
gtcaccctcgacaccgcgtgttcgtcctcgatcgtcgcgatgcacctggccatgcaggcg
ctgcgcgcgggggagtgcgagctggcgctggcgggcggggcgaccttgctgatgtcgccg
atcgcccatatcgagctgtgcaagctgggtgtgttgtcaccgacgggccggtgcgcgccg
ttctccgcggatgcggacgggacggtgtgggccgagggagccgggttggtgctgttgaag
cggctcagtgatgcgcggcgtgacggggaccgggtgctcgcggtcgtgcgcggctcggcg
gtgaaccaggacggccgcagtcagggactgagcgctcccaatggcgctgcccaagagcag
gtgttgcgctcggcgctgcgggcctcgggtctggcgccgcacgagatcgactacgtggag
gcgcacgggaccgggacggcgctcggcgatccgatcgaggcgcgggcgctggcgcgggtc
ttcgggccggggcgtgatccggcgcggccgctgggtgtcggttcgctgaaatctcatgtg
gggcatacgcaggcggcggcgggcgtggccagtgtcatcaaactggttctcgcgctgcag
cacgagcggatcccggcgacattgaacgcggcccaaccctcgccgcatgtcgattgggcg
cgcagcggggtggcggtgcaggcgcaggcggggccgtggcagcggggtgatcggccgcgc
cgggccggggtgagtgccttcgggttgagtggcacgaacgcgcacctgattctcgaggaa
gcgccgccgacgccggtcgaggaggccgatccgctcgccggtggtgtggcactgctgccg
atttcggcgcgtagcgaggcatcggtgcacgggcaggcgcggcggctgctcgacctggtg
gcggctgatccgcgatcggatccggggcaggtgtcgcgagcacttgccttgcagcgcagt
cagttcgagcgtcgggcggtagtggttgccgctgatcgcgccgggatggtcggcgcgctg
ggtgatctggtggctgggcgttcgtcggcggatgtcgcggtcggtaccggaccggtgctg
accaacgccaaaacggctttcgtctttcccgggcagggcatgcagtgggtcggcatggcg
ggcgacctgctgtcctccagcgccgagttccgggcggaattcgaactgtgtgacaaggca
ttcggcgcgcacatcgggtggtcgctggtcgatcggctcaccaccatggcacccgccgac
ctggtggacttccccgtcgtccagccgctgctgttcgcgacgatggccgccctggccgcc
acctggcgcgcggccggtgtcaccccggacgcggtgctcggtcacagccagggtgagatc
gccgccgcctactgcgccggagttctcgatctggatgatgctgcccggatcgtcgtcacg
cgcagccgcctcatgcaggccatcgacgaaccggccgcgatggcgatgatcggcctgccc
gaggccgaggtcgccacgcgactgctcgccttcgacggtcgggtgtcgatcgcggcggtc
aatgtgcgccggtcgacgatcgtggccggtgagcaggccgcggtgaccgaattgctggcc
gagctggatcgcgcggggatctacacgcggctcggggcgtccggtcccggactggccggg
cattgcggattgatcgaggtcattcgcgagccgctgaccgatcagctggccgatctcggc
gcgtcggcgcccaccatcgcctggtactcgacggtgacgggtgagctggtcaccgacgcg
ccggccgggcccgagtactggtatcgcaatgcgcgcgagaccgtgcggttcgcggccacc
gtcgagcggctgatcgccgacgggttccggtatttcgtcgaactcggcatgcacccgtcg
ctgacagcggcggtgaagacggtgtcggaggagctggagcgcgacgtgatcgccgtcggc
tcgctggttcgcgacgaggacgggccgaccagcctggccagggcacaggccgcgctgtat
gtcggcggtcatgatctggactggtcccgcctggccccggagcgcggacggatcgacctg
cccacctacgctttcgacgagcggagcttctggaccgagggggccaaccgcgacaccggg
tcgctcggactcgacgacatcacccatccggtgctgggagccgctgtgccgcagccggat
tcggacggtgtcaccctgacggggcggatctcgcgggcgaagcagccgtgggtggtggat
cacgcgggaccgcacgcggtgctggtgcccggtgcggcactggtcgaatgggccgtgcgg
gccggtgacgaagtggactgtccggtggtgcgcgagctggtgcttcgtgcgccgctgctc
gtgcccgagcaggggtctgtgcaggtgcaagtggtcgtcggcggggccgatcaggatcac
cgtcggacagtacggatctttgctcggtccgagaccgaccccgatgcgcagtggacgctg
cacgccgacgggattctcggtgaggagctcgatcactcactggcacagcgtgactcgttc
cgatcgccgccgccggcggccggtcccggtcccgccgccaccgtggggcgcaaccctgcg
gccgccatggacgcacccgaccacacagcagtcatcggcgcgccccaccgcgcagcgggt
accgcgctgtccggcgtgggatggagcgtcgggccgcgctcgggcagcccggacttcgac
ctgccgcacgatggagcgcaccatcccgggggagcaggtgattcggtgacttcggcccca
gctcggtcgtggccgcccaccggcgccactcgcgtcgatgtcgacgacctgtaccagagg
ctgttcgcccggggtcaccactacggccccctgttccgggcgatgcggaccgcctggcga
cgcgacgacgagatcttcgtcgaggtcgaactcgccgaatccgcacacggcgcggccgcc
gacttcggcatccacccggcccttctcgacgcggccctgcacgcgaccgccctgttcgcc
gccgacgacggcgggcacgccctcctgccgttcgtctggtccgatgtcgccctgtgggcc
accggcgccaccacgctgcgcgttcgactggcccgttccggcaccgacaccgtcaccatg
tccgcgaccgaccgcaccggccgacccgtggtatcggtcggctccttgctactacgcccg
gtcgaccccacccagtggcagtcggccaccctcgcccccgcccaccgccgcctgttccag
gtgaagtggaccccgttgccgctgtcccctgtacacggcgtacggagtctcggcgactgg
cacgacaccgaacccggtgcgacggatgcggtgatcttgactgttcccgagggcaattcg
actgtcgaagtgcacgacaccgcccagtacgtcctcggcgcactgcagagcttcctcggc
gacaaccgcttcgagacagcaacgctgatcgtgcgcacccaggctgtggtccccgtcgca
agttccggcctggccgccgtgcgcggagtcgttgccagccgcgatacggcgggtacacca
ggtgtgcgggtggtaggcggcgtggttgacgcaggcaccgactatgtcggggcgcgcgtg
tccagtggtgggaccggtcctgatcccgtgggtgcggtggtgtgggggctggtccggtcg
gcgcagtcggagaacccgggccggatcgtgctggtggacagtgcggatgccgacgtcgac
ttcgcggctgttctcgcgacaggcgagcagcaggtggcggtgctggagggcttggccttc
gcgcccaggttggctcggctgccagaagggccgacgccggcggggcgggtgtcgctcggg
gacggtgccgtgttggtgaccggggcgccggggcggttgggttcggcgctcgcccggcat
ctggccgacgcctacggggtgcgggatctggtgttggtcagccgacggggggtcgacggt
cccgggggtgcggaactgcgggacgatctcgagcagcggggtgttcgggtgcggttcgcc
gcgtgcgacatcaccgagcggccggcactggccgaactgctggacgggttgccgctggcc
ggtgtgatccatgccgcgtgcgttctcgatgacgccaccatcggctcgctcaccccggac
cagctcaccgctgtgctacgcccgaaagtcgatgcggcgcagcacttgcacgagctgacg
gcggaccgggacctgtcgatcttcgtgctcttctccgcggcgggcggtctgttcggcaca
ccgggtcaggcgaactacgcggccgccaacgcctatctcgacgccctcgcggtgcaccgc
cggtcactcgggctgcccgcgcagtcgctggcctggggtgcctgggacgtcgacatgcac
gagcacatggccgacgccgacatccggcgcatcgcgcgcgcgggcgtccgggccttctcg
gtgccagacggcatggcgtgcttcgatgccgcactggcacagggtgatccactgctggtt
ccgctgctgctcgacaccgaggtgctgcgacgctcacccgcggtcccgccgctgctgcgc
ggactggtgcgccgggcgccgcggcgggccgtggccgatcacgcggcggtcgatcctgcg
acgggctcggcgttcgcgcgcgagcttcgagcactcccgcgggcggaggccatcaccgtg
gtcacggccgccgtcgccgggtggaccggggaggtgctcgggcattcgggcacagcgacc
gtcgccgtcgaggagaccttccagagtctcggtctcgactcgctgatggcggtcgaactg
cgcaacaaggtgcgggcgcacaccgggatcgcggtgccgctcggcacgatcctcgccgaa
cagaacctcaccgacctcgccgcctacctggtcgaggaggtcgtgcggcaagactcccgt
tcggccgaaactgccgctgtcgaggtgcccgaggtcgaagtgctgccggtgaccagggac
atgatgcggctgctgcggaccgagcagctcggcatcccgagcgccgcgcagaccggcggt
gtggcggtgcggctgcgcacgcgggtcacccgggccgaactcgagcaggcagtggcccga
tcggctcgccgccatgcggcgatgcgcaccgccgtccgggccagtgacgcgaacgggcgc
cagctcgagatctaccgcgaggccgcgctgtcgatcggctggcggtccctcgaccatctc
gatgacgttgtcgtcgaggcacggttccgcgacctgatggccccggctttcgatgtggcg
accggtccgctgtggcgcttcgaactgctcgacgccgaatccaccgaccaggtcctgctc
gtcggcgcgcaccacgccatgagtgatgtgcagtcgatgctgttggtcgcgggtgaactc
gtcgccgaactgtccggaatccgcctcgatgacacggtgaccaaccgcgacctgcaccaa
ctgctggctgcccaaccggccaggcgcgacgacaacgcggtcgcccgctggcgtgccgcg
ttcgccggtgcgcagcggctcgaattgacactggcccggtcacgcccggccgaacgaggc
tacggcgccggtgcgctcgcgctggacatgccgcccggtctgcacgatcgggtcgccgat
cgggcgcgggagctcggcatcaccccggccgctgtcttcctcggtgcgctcaccgtaacg
ctcgcgcgcaggcagcagatcgatcggttcgccgtggccgttcccgtggacacccgcatg
catgccgatgcgacggacgccgtcgggtatttcggtgtgcccgtgcctttcccggcagcg
gtggaaaccggggacctcgtcgccgacgtcctgcgccgcaccggcgaccgcctgcgcaat
ctgctcgcacccggcgcgggcttcgccgaagtgatcgccgcgctcgccggggagggcctc
gcccgcgacaacgcgccgctggtggaggtgtacttcaactacctgcgcgccaattcggcc
gtcggccgggccgagatcgtccccgtgagcacggggtactccgacctcgacctcatgatc
gcggtgctgcccgacaccgggcaggtctggttcacctacaacaccgacatcatcgacgcg
cggacctgcaccgccttcgggaccgactacctggcggtggtcgaagcggccgtcgccgac
cccggagcgcccgtcggtgccgaagcggtgggaccggaggctgtttcgggtgttcgggcg
gcggtggccgccacgttcgcgctcggcaggctgccggagttgctggtcgccgcatcatcc
gagaacgcgctgtccgtcgcggaggcgccgtaccaccacgtgctggcgtgcctgcgcgat
ccgtcgggggtgttcgcgcaaccgtcgaccacgctcggcgtgctgctgatgcgggcggcg
gatctggaacggttcggtgaggtcaccgacgaggtcctcgccgagctcgccgtcgagttc
cccacggtgatcaagggagtcgtcgagcgtacgggccggtcgatcatcgtcggcatcgca
ccgacgcggcgatccacggaacggctgatcgagtgggagcggactgtcgtcgagaacctt
cgcgatgttcccggtatcgcggtgctcgaggcggagcagtggacgcgcctgcacgcggtg
gccgatccctacgacgagcggaccgaagtcctggcgcacttgccgttcacaccggaattc
caggcggccatggcgctgacgctgacggcgactgtcaccgccgttgtcgagcccgcgccg
aaggtcatcgcggtggatggcgacgacaccttgtggagcggcatcgcgggcgaaatcggt
gtcactggagtcgaattcgacgcgccacgtcgtctgctggcgcggcgactgcggcaatgg
cgtgcggcggggaccttgttggtgctggtgagcaacaacgacgaggacatcgttcgggcg
attctggaccggccggacagcccgctgagtcccgctgccttcgccgccatctccgcgagc
tgggacggcaaaccggaccgtgtggagaacatcgcccgcaccctgggtctcggtctcgac
accttctgcttcctcgacgacaaccccgtcgaggtggcgcggatgcgtgcgcaactgccc
gaggtgctgtgtgacctgcccgcccgccgaggcgctcgaatcgttcctcacccgcctgtg
gccactggtaccgctcgccgcgaccatcgaggaccgcctgcgcgccgacttctatcgcca
ggaatccgaccgcgaccatgcccgtgccgcactggaattcgaggagttcctcgatcaact
ggcactcgaggtcgacatcgagccactgaccgaggacaccacgacccgggcacgacaact
cgtgcgccgcaccacccagttcaccctcggcaccgccaccgccgacgacctcgaccggtg
gcgcgagcacggcgaggtctggacggccaccgcccgcgaccgcttcggcgactacggcct
gatctcggtactcgccctgcggaacgagggcgacgttctccggatcaccggctggcaact
cagctgccgagccctcgcccgcggcgtcgaagaacgactcctccaatgggtggccgaccg
cgccgacgccctcggctgcgcgacggtccacctgtcggtcgaccacacgccccgcaacga
accggcccgccgcctggccgcccgcctgcacggcagctcgaccagtga

DBGET integrated database retrieval system