KEGG   Nocardia seriolae: NS506_05464Help
Entry
NS506_05464       CDS       T04599                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nsr  Nocardia seriolae
Pathway
nsr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nsr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NS506_05464
Enzymes [BR:nsr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NS506_05464
DNA repair and recombination proteins [BR:nsr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NS506_05464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APA99510
UniProt: A0A1I9ZC47
LinkDB All DBs
Position
5736556..5737506
Genome map
AA seq 316 aa AA seqDB search
MSGLPHYAPMLATAGIVPGDDAQWSYEVKFDGIRAIGYIGEELRLLSRNDRNITAAWPEL
AGLAPSDPPFVVDGEIVAFAPDGRSSFAALQPRMHQRNPATIAALAAATPATYMIFDLLH
IGDRPLINLPYEQRRQLLEQLAPHGPHWQTPPRLNGPGTAVLEQSRRLGLEGIICKRLDS
TYQPGRRSPRWIKVKNIRDQEIVIVGWRPGSGARAGHIGSLLMAVHDATGQLTYIGNVGT
GFTRATLDALAAKLEPLQRHTPTVAAPVPDAVWVEPELVGEVSYSDWTTDGRLRHPSWRG
LRADKTPREVTLPDDR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggctaccgcactatgccccgatgctggccacggccgggatcgtccccggcgac
gacgcccagtggagctacgaggtcaaattcgacggcatccgcgccatcggatacatcggc
gaggagctgcggctgctgtcgcgcaacgacaggaacatcaccgcggcctggccggagctg
gccgggctcgccccgtcggatcccccgttcgtcgtcgacggcgagatcgtggcgttcgcc
cccgacgggcgctcctccttcgcggccctgcaaccccgcatgcaccagcgcaatccggcc
accatcgccgccctggccgccgccaccccggccacctacatgatcttcgacctgctgcac
atcggcgaccgccccctgatcaacctgccctacgagcagcgccgccaactcctcgagcaa
ctcgccccgcacggcccgcactggcagaccccgccgcgcctgaacggccccggcacagcg
gttctggagcaatcgcgacgcctcggcctggagggcatcatctgcaaacgcctcgacagc
acctaccagccgggccgccgcagcccgcgctggatcaaggtcaagaacatccgggaccag
gagatagtgatcgtcggctggcgtcccggcagcggcgcgcgcgccggtcacatcggctcg
ctgctgatggccgtccacgacgccaccgggcagctcacctacatcggtaatgtcggcacc
ggtttcacccgcgccaccctcgacgccctggccgcgaaactcgagccgctgcaacgacat
acgcccaccgtcgccgcccccgtcccggacgcggtctgggtggagcccgagctcgtcggc
gaggtgagctactccgattggaccaccgacggccgcctgcgccatccgtcgtggcgcggc
ctgcgtgccgacaagaccccgcgcgaggtcacgttgccggacgaccgttga

DBGET integrated database retrieval system