KEGG   Nocardia seriolae: NS506_07452Help
Entry
NS506_07452       CDS       T04599                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
nsr  Nocardia seriolae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nsr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NS506_07452
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NS506_07452
Enzymes [BR:nsr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NS506_07452
Peptidoglycan biosynthesis and degradation proteins [BR:nsr01011]
 Precursor biosynthesis
  Racemase
   NS506_07452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7785460..7786596)
Genome map
AA seq 378 aa AA seqDB search
MNTPDPQVEILVDLDAIAHNVRILAEHAGDAAVMVVVKADGYNHGAAEVARAALAAGARE
IGTTTIAEAVELRAAGITAPILCWLNTSDADYASAIAADIELGVSTLSELEAVGAAARGL
DRTAIVTLKVDTGLNRNGIPGTEFPEVLELLAKLVADGTVRFRAIFSHLALADEPQHPVN
DMQRGRFLEFIATAKQHGLEPELVHLANSAAALTRPDLAFDMVRPGIAVYGLSPIPELSD
FGLRPAMTFRARVLRIKKVAAGEGVSYGHDWVAERDTTVALVPAGYADGVPRPLGGRFSV
WIGGERHPQIGRVCMDQIVVDLGDNAADVRAGDTAILFGGAPGHPRADEWAVALGTINYE
IVCGPRGRVIRTHLGGNR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacgcccgacccccaggtggaaattctcgtcgatctggacgccatcgcccacaat
gtgcgcatcctggccgagcatgccggagacgccgcggtcatggtcgtcgtcaaggccgac
gggtacaaccacggggcggccgaggtggcgcgggcggcgctggcggccggggctcgtgag
atcgggaccaccaccatcgccgaggctgtggagctgcgggcggcgggcatcaccgcgccg
atcctgtgctggctcaatacttccgatgccgattacgcgagcgccatcgccgcggatatc
gaactcggcgtttccacgctgtcggagctggaggcggtcggcgcggccgcgcgcgggctg
gaccgcaccgccatcgtcaccctgaaggtcgacaccggcctgaatcgcaatggcattccg
ggcacggagttccccgaggtgctcgagctgctcgcgaagctggtcgccgacggcacggtc
cgtttccgcgccatcttctcccacctggcgctggccgacgagccccagcatccggtcaat
gacatgcagcgcggccgcttcctggagttcatcgccaccgcgaagcagcacggcctggag
cccgaactggtgcacctggcgaattccgctgccgcactgacccgtccggatctggccttc
gacatggtgcgtcccggcatcgccgtctacggcctgtcaccgattccggagctatccgat
ttcggcctgcgcccggccatgaccttccgcgcccgggtactgcgcatcaagaaggtcgcc
gcgggtgagggcgtgtcctacggccacgactgggtcgccgagcgcgacaccaccgtcgcc
ctggttccggccggttacgccgacggcgtcccgcgcccgctgggcggccggttctcggtc
tggatcgggggtgaacgccacccgcagatcggccgggtctgcatggaccagatcgtggtg
gacctcggcgacaatgccgcggacgtccgggcgggcgataccgcgatcctgttcggcggt
gcgcccggtcacccccgcgccgacgagtgggccgtcgcgctcggcaccatcaactacgaa
atcgtgtgcggcccgcgcggccgcgtgatccgcactcacctgggcggtaaccgatga

DBGET integrated database retrieval system