KEGG   Nicotiana sylvestris: 104241776Help
Entry
104241776         CDS       T05026                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00010  Glycolysis / Gluconeogenesis
nsy00051  Fructose and mannose metabolism
nsy00052  Galactose metabolism
nsy00500  Starch and sucrose metabolism
nsy00520  Amino sugar and nucleotide sugar metabolism
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01200  Carbon metabolism
Module
nsy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nsy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104241776
   00051 Fructose and mannose metabolism
    104241776
   00052 Galactose metabolism
    104241776
   00500 Starch and sucrose metabolism
    104241776
   00520 Amino sugar and nucleotide sugar metabolism
    104241776
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104241776
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104241776
Membrane trafficking [BR:nsy04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104241776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104241776
NCBI-ProteinID: XP_009795017
UniProt: A0A1U7XSI5
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MGKVVVGAAVVCTAAVCAAAVLLMRHKMKNSGKWAKAMDMLKEFEEKCETPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKR
IVKQEVKEVSIPKNVMAGSSSDALFDFIATTLVKFVATEGDDFHLPPGRQRELGFTFSFP
VKQLSIASGTLIKWTKGFSIDDAVGQDVVRELTKAMERVGLDVRVAALINDTVGTLAGGR
YNNPDVIAAVILGTGTNAAYVERANTIPKWHGLLPKSGDMVINMEWGNFRSSHLPVTEYD
QSLDAESLNPGEQIYEKMISGMYLGEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTQD
MSAMHHDKSADLKVVGDKLKDILEVPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILK
KLGRDTLKDGEKQRSVIAVDGALFEHYTKFRNCMEGTIKELLGDAAENIVVKLSNDGSGV
GAALLAASHSQYLGLEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggtggtgggtgcagcagtagtatgtacagctgcagtatgtgctgctgct
gttttattaatgaggcacaaaatgaaaaattcaggtaaatgggctaaagctatggatatg
ttgaaagagtttgaggagaagtgtgaaactccaataggaaaacttaggcaagtggctgat
gctatgactgtagagatgcatgctggacttgcttctgaaggcggtagcaaactcaagatg
ctcattagctatgttgataacctccccactggggacgaaaccggtctgttttatgcatta
gatctaggcggcacaaacttccgtgtgatgcgtgtgcagttgggcgggaaagaaaagcgt
atagttaaacaagaagttaaagaagtttcaattccaaagaatgtgatggctggatcgtca
tctgacgcgttatttgattttattgccacgacgcttgtaaaatttgttgctacagaaggc
gacgattttcatcttccacccggtagacaaagggagttgggcttcaccttctctttccca
gttaaacaactgtcaattgcatcaggaactcttattaaatggacaaagggcttctctata
gatgatgcggttggccaagatgttgttagagagttaacaaaagcaatggaaagggtcggt
cttgacgtgcgcgtggctgctttgataaatgatactgttggaacattagcaggaggtcgg
tataacaaccctgatgtcattgctgcagtaatattgggtactggaaccaatgcagcatat
gttgagcgggcaaatacgattccgaaatggcatggtctgctgcctaaatcaggagatatg
gttattaacatggaatggggtaatttccgctcatcacatcttccggtaacagaatacgac
caaagtcttgacgctgagagtttaaacccaggggagcagatttatgagaagatgatttcc
gggatgtatcttggagaaattttgcgcagagtcttgtgtagaatggctgaagaagcttca
ttttttgatgattatgtcccaccaaaactgaaaactccattcattttaaggactcaggac
atgtctgctatgcatcacgacaagtctgctgatctcaaggtggttggcgacaagctgaag
gatatcttagaggtacctaattctacctggaaaatgaggaaaataattgttgagctatgt
gacattattacctctcgtggagctcgtctttctgcagcaggaatcgtgggtatcctcaag
aaattgggaagagacactttgaaggatggagagaagcagaggtcagtaatagctgttgac
ggtgcattgtttgagcattacacaaagttcagaaattgcatggagggaactattaaagag
ttgttgggagacgccgcagaaaacatagtcgttaagctttcgaatgatggttctggtgtt
ggagctgcactattggctgcttctcattcccagtacctcggactcgaggaatcttga

DBGET integrated database retrieval system