KEGG   Nicotiana tabacum (common tobacco): 107770541Help
Entry
107770541         CDS       T04643                                 

Gene name
Hxk4b
Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107770541 (Hxk4b)
   00051 Fructose and mannose metabolism
    107770541 (Hxk4b)
   00052 Galactose metabolism
    107770541 (Hxk4b)
   00500 Starch and sucrose metabolism
    107770541 (Hxk4b)
   00520 Amino sugar and nucleotide sugar metabolism
    107770541 (Hxk4b)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107770541 (Hxk4b)
Enzymes [BR:nta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107770541 (Hxk4b)
Membrane trafficking [BR:nta04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107770541 (Hxk4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MGKVVVGAAVVCTAAVCAAAVLLMRHKMENSGKWAKAMDILKEFEEKCETPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKR
IVKQEVKEVSIPKNVMAGSSSDALFDFIATTLVKFVATEGDDFHLPPGRQRELGFTFSFP
VKQLSIASGTLIKWTKGFSIDDAVGQDVVRELTKAMERVGLDVRVAALINDTVGTLAGGR
YNNPDVIAAVILGTGTNAAYVERANTIPKWHGLLPKSGDMVINMEWGNFRSSHLPVTEYD
QSLDAESLNPGEQIYEKMISGMYLGEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTQD
MSAMHHDKSADLKVVGDKLKDILEVPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILK
KLGRDTLKDGEKQRSVIAVDGALFEHYTKFRNCMEGTIKELLGDAAENIVVKLSYDGSGV
GAALLAASHSQYLGLKES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggtggtgggtgcagcagtagtatgtacagctgcagtatgtgctgctgct
gttttattaatgaggcacaaaatggaaaattcaggtaaatgggctaaagctatggatata
ttgaaagagtttgaggagaagtgtgaaactccaataggaaaacttaggcaagtggctgat
gctatgactgtagagatgcatgctggacttgcttctgaaggtggtagcaaactcaagatg
ctcattagctatgttgataacctccccactggggacgaaaccggtctgttttatgcatta
gatctaggcggcacaaacttccgtgtgatgcgtgtgcagttgggcgggaaagaaaagcgt
atagttaaacaagaagttaaagaagtttcaattccaaagaatgtgatggctggatcgtca
tctgacgcgttatttgattttattgccacgacgcttgtaaaatttgttgctacagaaggc
gacgattttcatcttccacccggtagacaaagggagttgggcttcaccttctctttccca
gttaaacaactgtcaattgcatcaggaactcttattaaatggacaaagggcttctctata
gatgatgcggttggccaagatgttgttagagagttaacaaaagcaatggaaagggtcggt
cttgacgtgcgcgtggctgctttgatcaatgatactgttggaacattagcaggaggtcgg
tataacaaccctgatgtcattgctgcagtaatattgggtactggaaccaatgcagcatat
gttgagcgggcaaatacgattcccaaatggcatggtctgctgcctaaatcaggagatatg
gttattaacatggaatggggtaatttccgctcatcacatcttccggtaacagaatacgac
caaagtcttgacgctgagagtttaaacccaggggagcagatttatgagaagatgatttcc
gggatgtatcttggagaaattttgcgcagagtcttgtgtagaatggctgaagaagcttca
ttttttgatgattatgtcccaccaaaactgaaaactccattcattttaaggactcaggac
atgtctgctatgcatcacgacaagtctgctgatctcaaggtggttggcgacaagctgaag
gatatcttagaggtacctaattctacctggaaaatgaggaaaataattgttgagctatgt
gacattattacctctcgtggagctcgtctttctgcagcaggaatcgtgggtatcctcaag
aaattgggaagagacactttgaaggatggagagaagcagaggtcagtaatagctgttgac
ggtgcattgtttgagcattacacaaagttcagaaattgcatggagggaactattaaagag
ttgttgggagacgccgcagaaaacatagtcgttaagctttcgtatgatggttctggtgtt
ggagctgcactattggctgcttctcattcccagtacctcggactcaaggaatcttga

DBGET integrated database retrieval system