KEGG   Nicotiana tabacum (common tobacco): 107777621Help
Entry
107777621         CDS       T04643                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    107777621
Enzymes [BR:nta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107777621
Transporters [BR:nta02000]
 Other Transporters
  Pores ion channels [TC:1]
   107777621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 107777621
NCBI-ProteinID: XP_016453165
UniProt: A0A1S3YMK4
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MAEELKLHRTWSSPFGLRAVWALHIKGIQYDTIYEDLSQKSPELLQHNPVHKKIPVLVHK
GKPICESLVILEYIDETWKEAPLLPQDPYEKATVRFWAKFGEEKLLPSIWSVFTGQGNEK
NEALGPAVQNLELFEEQLKEKKFFGGEEIGYLDLSLGWLAYLLDVFEEVIDLKLFDAAKL
PLLSAWMNNFYDAPVIKEHWPPRDKLVTKFQLLHENYQKAFAAK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaactcaagcttcacagaacatggtcgagcccatttggtttgagggctgtt
tgggcactacacatcaaagggatccaatatgacactatttatgaagatttaagtcagaag
agccctgaactcctgcagcataatcccgttcacaaaaaaattcctgtgcttgtacacaaa
ggcaaaccaatctgtgaatcactggtaattctcgagtatattgacgagacttggaaggaa
gctcctttgttacctcaggacccttacgagaaagccacagtgcgtttttgggcaaaattt
ggggaggagaagcttctgccatcaatatggagtgtattcacaggacaaggaaacgagaaa
aacgaagctcttggtccagcagtacaaaatctagaactctttgaagagcaactgaaagag
aagaaattttttggtggagaggaaataggatacctggacctttcacttggttggttggca
tatcttcttgatgtatttgaagaggtaatcgacctgaagttgttcgatgcagccaaatta
cctctcttgtcagcatggatgaataacttttatgatgctccagtaatcaaagaacactgg
ccacctcgagacaaattagtgaccaaattccagctgcttcatgaaaattaccagaaagca
tttgctgctaaatga

DBGET integrated database retrieval system