KEGG   Nicotiana tabacum (common tobacco): 107791770Help
Entry
107791770         CDS       T04643                                 

Gene name
rbcS
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain S41, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00630  Glyoxylate and dicarboxylate metabolism
nta00710  Carbon fixation in photosynthetic organisms
nta01100  Metabolic pathways
nta01200  Carbon metabolism
Module
nta_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nta_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nta_M00532  Photorespiration
nta_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107791770 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107791770 (rbcS)
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107791770 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 107791770
NCBI-ProteinID: XP_016469390
UniProt: A0A1S3ZY67
LinkDB All DBs
Position
Un
AA seq 181 aa AA seqDB search
MASSVMSSAAAVATGANAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQ
VWPPINKKKYETLSYLPDLSQEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYY
DGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcagttatgtcctcagcagctgctgttgcgaccggcgctaatgctgctcaa
gccagcatggttgcacccttcactggcctcaagtccgcctcctccttccctgttaccagg
aaacaaaaccttgacattacctccattgctagcaatggtggaagagttcaatgcatgcag
gtgtggccaccaattaacaagaagaagtatgagacactctcataccttcctgatttgagc
caggagcaattgcttagggaagttgattaccttttgaaaaatggatgggttccttgcttg
gaattcgagactgagcacggattcgtctaccgtgagaacaataagtcaccagggtactac
gatggtagatactggaccatgtggaagttgcccatgttcgggtgcactgatgccactcag
gtcttggctgaggtagaggaggcaaagaaggcttacccacaggcctggatcagaatcatt
ggattcgacaacgtccgtcaagtgcaatgcatcagtttcatcgcctacaagcccgaaggc
tactaa

DBGET integrated database retrieval system