KEGG   Nicotiana tabacum (common tobacco): 107791770Help
Entry
107791770         CDS       T04643                                 

Gene name
rbcS
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain S41, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107791770 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107791770 (rbcS)
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107791770 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 181 aa AA seqDB search
MASSVMSSAAAVATGANAAQASMVAPFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQ
VWPPINKKKYETLSYLPDLSQEQLLREVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYY
DGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcagttatgtcctcagcagctgctgttgcgaccggcgctaatgctgctcaa
gccagcatggttgcacccttcactggcctcaagtccgcctcctccttccctgttaccagg
aaacaaaaccttgacattacctccattgctagcaatggtggaagagttcaatgcatgcag
gtgtggccaccaattaacaagaagaagtatgagacactctcataccttcctgatttgagc
caggagcaattgcttagggaagttgattaccttttgaaaaatggatgggttccttgcttg
gaattcgagactgagcacggattcgtctaccgtgagaacaataagtcaccagggtactac
gatggtagatactggaccatgtggaagttgcccatgttcgggtgcactgatgccactcag
gtcttggctgaggtagaggaggcaaagaaggcttacccacaggcctggatcagaatcatt
ggattcgacaacgtccgtcaagtgcaatgcatcagtttcatcgcctacaagcccgaaggc
tactaa

DBGET integrated database retrieval system