KEGG   Nicotiana tabacum (common tobacco): 107803852Help
Entry
107803852         CDS       T04643                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2-like
Organism
nta  Nicotiana tabacum (common tobacco)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 107803852
NCBI-ProteinID: XP_016483129
UniProt: A0A1S4B2S7
LinkDB All DBs
Position
Un
AA seq 1537 aa AA seqDB search
MASQISIGDDVCEFGQSSSAMNPNCTTGNLSVSLQSSQSFEIKDDDVPQRMVALDVSETD
VLVNAFDSISITEALPRKMDDKSKDTVKTDNASESECPVNVCIAPRRRSGRNIKLSQNLA
TVPATSGRRIANKKASIDLSSLQITRKRRSYFSKQARSSVWGLLENMVQSFEHNIRLEIT
SGEQKNIRTATKGSRRNEKHGENQIDRKSRKSKGKRFIPTGPISLKVKFGHRCLMDVIPL
IDNDTNKNCTTVEELKKLPKIASKVDDRLGEELLDMQLHGCNGNSHNDYVSLSDGCQPGK
NAVQDTDAKTLVCHDGSLSQEGESIGNRFSDPGTSPDSEVINLIPDTPVNVPEDLHDLTL
SKPCAAPGDAPILMHEKISKKERKIYMLPKVSNCGVKDLLSPESMSNEQVFWNLMQGEKQ
RDGSCCCDTSVLTTAGNGTGNMFSNEIFSGELLHCSGLSGLGISCASSKLESDLEGNHCS
SLGTESPESGLSEKLVSSPDERKVSKVGRPKVSGKRRSEVPKPSKRRGCKKKENKEKEDI
MHEVKHKSDLAKGLCEVRQHPGTENGTPSGLGQIGSEKKILGGGVSNLDILPTEVGERLL
PPRNAWVQCDDCHKWRRIPSFLADQIEETNCRWTCMDNLDKAFADCSFPQEKSNSEINAE
LEISDEEDVSRVHLSSNGSGQKNSLVAHQSSWSRIKSNMFLHRNRKNQTVDEIMVCHCKP
PSDGRMGCGDGCLNRMLNIECVKGTCPCGEFCSNQQFQKRNYAKLKCFKCGKKGYGLQLL
EDVYEGQFLIEYVGEVLDMHAYEARQKEYALKGHKHFYFMTLNGSEVIDACAKGNLGRFI
NHSCDPNCRTEKWMVNGEVCIGLFALRDIKKGEEVTFDYNYVRVFGAAVKKCVCGSPHCR
GYIGGDPLNAEVIVQDDSDDEYPEPVMLHGDADMNHKQDNSICATSAISVAEIKIQGKPP
KNRNTMDESFAGNQDTSHQTHMNSIVGLENVNLGNSVAVVSLNAREERENFPDGSPASSL
NDETSVALEASECMSHSSVQPVETSLSLKDTCETMSGVTKECSVAGEVSKNSFSSTQEFE
VTSLDAVVSKSLRKSKSSNGRETHDPLKPCPFVKTSRESSLVKKVKQRNNAVNSRPLPDV
DSMLQVSQPKFKKPPDGSLHGHFEAVEEKLNELLDHNGGISKRKDASRCYLKLLLLTAAS
GDGCNGEAIQSNRELSMILDAILKTKSRTVLMDIMNKNGLQMLHNIMKRYRREFNKIPIL
RKLLKVLEYLAVRDILSPEHINGDTSRAGVESFRDSILGLTEHKDKQVHQIARNFRDRWL
HRPLRNRSCIDRDDSRINMHSGSPYNRCLASQNPWCDFGGKPSEAAQNTCHSTVSSVQAD
ACVPDGSSASCSDIGATSRPRKRKHKSRWDQEAEEKPDPRNESHVADDRRQVLDYDAPPG
YEFPPGFLFPVEACRVLSDASSAAICSPEECRCREHQQPVVMGNLQQRFISRLPVSYGIP
FSEVQQFGSPQKGRFDAWTVAPGIPFQPFPPFASISL
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcagatatcaataggagacgatgtctgcgagttcgggcagagttcatctgcc
atgaatcccaattgcacgaccggaaacttatctgtctctttgcaatcatctcaatccttt
gagataaaagatgatgatgtgcctcagagaatggttgcacttgatgtttcagaaactgat
gttcttgtgaatgcttttgactcaattagcataactgaggcgttgccccgtaagatggat
gataaaagcaaagatactgtaaaaactgataatgcctctgaaagtgaatgccctgtcaat
gtatgtattgcccctcggagaaggagtgggcgcaacatcaagttaagccagaatctggct
acagtaccagcaacaagtggcaggagaatagccaataaaaaggcatccatagatcttagt
tccttgcagattacaagaaagagaagaagctatttcagtaaacaagctcgttcttcagtt
tggggtttgctagaaaatatggtgcaatcttttgaacataatatcaggcttgagataact
tcgggggagcagaaaaatataagaacagcaactaagggtagtaggcgaaatgagaagcat
ggtgagaatcagattgatcgaaagtcacggaaatcgaagggtaaacgcttcataccaact
ggacctatctccttgaaggttaaatttggtcaccgttgcctgatggatgttattcctctt
attgataatgatactaacaaaaattgtactactgtagaagaacttaaaaaactgcctaaa
attgccagcaaagttgatgataggttgggggaggagttgttggatatgcagctccatggt
tgcaatggaaattcgcataatgactatgtttctttatcagatggatgccaacctggaaag
aacgcagttcaagatacagatgctaagactttagtttgccatgatgggtcactttcccag
gagggagaatcgatcggtaacaggttttcagatccaggaacttcacctgattcagaagtc
atcaacctgattcctgatactccagtcaatgttccagaggacttgcacgatttgactttg
tctaagccatgtgctgctcctggggatgctccaattttgatgcatgagaagatcagcaaa
aaagaaaggaaaatatatatgctcccaaaggtttccaactgtggtgtgaaagatttgctt
agtccagaaagtatgagcaatgaacaagtattctggaatctcatgcagggagaaaaacaa
agggatggttcttgttgttgtgatacttctgttttaactacagctggaaatggaacgggt
aacatgttcagcaatgagatattttcaggagaactgttacattgttcaggattgtcaggc
ttgggaatctcctgtgcttcctcaaagctggaaagtgatctagagggcaatcattgttct
agtcttggcactgagtctccggagtcagggttgtcagagaaactggtatcctctcctgat
gagcgaaaagtttctaaagtgggaagaccaaaggtatcaggaaagagaaggtcagaagtc
ccaaagccgtcaaaaagaagaggttgtaaaaagaaggagaacaaagaaaaggaagacatt
atgcatgaagtgaagcacaaaagtgaccttgctaagggtttatgtgaagtgagacagcac
cctggaacagaaaatggaacaccatctgggcttggacaaattggctctgaaaagaaaatt
ttaggtggaggcgtttcgaacttggacattctgccgactgaggtaggcgagcgtctcttg
ccaccaagaaatgcttgggtgcagtgtgatgattgccataaatggaggcgtataccttcc
ttccttgctgatcaaatagaagaaacaaactgcagatggacttgtatggataatctggat
aaagcttttgccgattgctcatttccccaagagaagtcaaattcagaaattaatgctgag
ctggaaatatcagatgaggaagatgtttctcgtgtgcacttgagttcgaatggatcagga
cagaaaaattcacttgtggcccatcaatcatcttggtctcggatcaagtcaaacatgttt
ttgcatcgcaaccgcaaaaatcaaactgttgatgagatcatggtctgccattgcaagcca
ccttcagatggtcgaatgggctgtggagatggatgcctgaaccggatgctcaatatagag
tgcgttaaagggacttgtccttgtggagaattctgttcaaatcaacagttccagaaacgc
aattatgctaaactgaagtgctttaaatgtggaaagaagggttatggcctgcagctgctt
gaagatgtatatgaagggcagtttcttattgaatacgtcggggaggtgctggatatgcat
gcttacgaggcacggcaaaaagagtacgcattgaagggtcataagcatttttatttcatg
acacttaacggcagtgaggtaattgatgcatgtgctaagggtaatttgggccgttttatc
aaccatagctgtgaccctaattgtcgtaccgaaaagtggatggtgaatggcgaggtctgc
attggactctttgctttaagggacattaagaagggcgaagaggtgacatttgactacaat
tatgtccgagtcttcggggctgcagttaaaaagtgtgtctgtggctcacctcattgtcgg
ggctatataggtggtgacccgctaaatgcagaagtgattgttcaggatgattcggatgat
gagtatcctgaacctgtcatgctgcatggggatgctgacatgaatcataaacaagacaac
agtatatgtgctacaagtgctattagtgttgctgaaattaaaattcaagggaaaccacct
aaaaacagaaatacaatggatgaatcttttgctggaaatcaggatacttcccatcaaaca
catatgaacagtatcgtgggtctagaaaatgttaatttgggtaactccgttgctgttgtt
agcttgaatgctagagaggaaagagaaaacttccctgacgggtctcctgcatcatcttta
aatgacgaaacatctgtggcactggaagcctcagagtgtatgtctcattcttctgttcaa
cctgtagagacttctttgtcattgaaggatacatgtgaaaccatgtccggagtgacaaaa
gagtgctcagtagctggcgaagtatcaaagaactctttctcctccactcaggaatttgag
gtaacttctcttgatgcagtggttagcaagtccttgagaaagtcaaaatccagcaatggg
cgagagacacatgatcccttaaaaccctgtccttttgtgaaaacttcacgtgaatcatct
ttagtgaagaaggtgaaacagaggaataatgctgtgaattccagacccctgcctgatgtg
gacagcatgttgcaagtttcacaacctaaattcaagaaaccaccggatggctccttacat
ggccattttgaagcagttgaagagaaactgaatgagttgctggatcataatggtggaata
agcaaacgcaaggatgcgtcaaggtgctacttgaagctcctccttttaactgctgcttca
ggggatggctgcaatggtgaagctatccagagtaaccgggaactttctatgatccttgat
gcgatcttgaaaacaaagtcacgcacagttttgatggatattatgaataagaatggtcta
cagatgttacacaacataatgaagcgatacaggagggaattcaataagatcccaattctc
agaaagttgcttaaggttttagagtatctagctgtaagagacatcctttctcctgagcac
atcaatggagacacgtccagagctggagttgagagctttagggactcaattttgggattg
acagagcacaaagacaaacaggttcatcaaattgcaaggaactttagagataggtggtta
cacagacctctcaggaacagaagctgcattgacagagatgacagccgaatcaacatgcat
tctggttcaccttacaataggtgtctagcatcacaaaatccatggtgcgattttggtggt
aaaccttcggaagcagctcagaatacctgccattcaacagtttcatctgttcaagcagat
gcttgtgtgcctgatggctcctctgcttcatgttctgatatcggggcaacctctaggcca
aggaaacgtaagcataaaagtcggtgggatcaagaggctgaagaaaagccagatccaaga
aatgagagccatgtagctgatgacagaaggcaggtcctagattacgacgctccccctggt
tatgaattccctcctggatttttattcccggttgaagcttgtagggttttatctgatgcg
tcttcagcagctatttgtagtcccgaagaatgtagatgcagagaacatcaacagccagtc
gttatggggaacttgcagcagcggttcatttcacgattgcctgtctcttatggaattcca
ttttctgaggtgcagcaatttgggtctcctcaaaaaggaagatttgatgcttggactgtt
gccccaggaatacctttccagccttttcctccttttgcctccatatccctgtga

DBGET integrated database retrieval system