KEGG   Neurospora tetrasperma: NEUTE1DRAFT121515Help
Entry
NEUTE1DRAFT121515 CDS       T03451                                 

Gene name
NEUTE1DRAFT_121515
Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
nte  Neurospora tetrasperma
Brite
Enzymes [BR:nte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NEUTE1DRAFT121515 (NEUTE1DRAFT_121515)
Chromosome and associated proteins [BR:nte03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     NEUTE1DRAFT121515 (NEUTE1DRAFT_121515)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 20824140
NCBI-ProteinID: XP_009849974
JGI: Neute_matA2_121515
UniProt: F8MIB6
LinkDB All DBs
Position
Unknown
AA seq 1161 aa AA seqDB search
MPSSSSAAFHNRPSSSTRLSRTASKGQLDKNNAEGDLTQSLNHLSISLASPSSVTSQSPS
PRKSPRSANHPPPAISPLRPQFATSTAGSPNGTPSRPGSAMRNVSYGRPPSRSQTPALRR
KASMNSIQVAHNSNGHGLRRSSSVNLTPSAAKKSPLNDMSPDTSEFKVPPTPQSIASDHF
KAELEIHHGHDPKLSAETIVILNDACYGHRYSRPRTSKASLSTIVERPERIKASVLGVSA
AYVRLGERHQDGSFPIHPDQHPRNLPSVPFLIQKTTRRLAITSPTVTNVHGTKWMEELKI
MCDTAEAKLATNGKELQRPDMDRGPNAEEPPKFHEGDLYLCAESLDAMEGALGGVCEAVD
AVFKPEGPKRAFVAIRPPGHHCSASYPSGFCWVNNVHVGIMHAILSHGLTHAAIIDFDLH
HGDGSQQIAWQHNSRGVKAAKNAAMWKKTSIGYFSLHDINSYPCETGDDEKVMNASVCID
NAHGQNVWNVHLQPWETEEDFWALYESKYTVLLEKARSYLVTEAERLRAAGQNAKAAIFL
SAGFDASEWEGAGMQRHEVNVPTEFYARLTRDVVRIAAEVDTAVEGRIISVLEGGYSDRA
LCSGIMSHVCGLAGAGSTGNGKAHDQYNPSWWSAAALEHLETTLLTPPPEPPKPPRNVAT
PTYCSPTQASTARSVAPRRTNRPMSPMPSRIPMPPAPEVPWAIAACELSKLLIPRDRQTD
SCTHTDLNAEATKARRERQLAQANTSASDAGTANSSDRPSTRMALRERKAKQAVPIKEED
TDEDRVNAVSAGKTGVPRGGARATRSRRLSAASTIVPDSLDSSPPSHRYSATNAEDDGRP
ETSMSIRPESSMSVRPQGNPLVVNKTRGPAKNKDALQAPRTQRKISTSTIESARSSNASL
VSPASASLNDQPSTGSNGDGVDTVTGGMKKVKITLITQAQKEARERERAANENAGAISVV
TSNLQENKLRQQQPTQTPVATVQSPTESNTTSPAPSTQFYTPNSQGRNSFSSSEDMDATD
KYPELFGHHHLQDGDGDIDMEDFEIPALASTPMPSRTSFPLPLRPLQQSSTPLENFIQYQ
PPAGKHHASVPAQTPTSPGHAMNRKDVPVFTATSAIPFSPQKTEQLQQSPAPSTPASLPS
VIFAGQKQEEKEEAVETPERN
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgtcctcctccgccgcgttccacaacaggccatcatcctccacacggctgtca
cgaacggcgagcaaagggcaactggataagaacaatgccgaaggggacttaactcagtcc
ttgaatcacctctccatctctctcgcgtccccgtcctccgtcacttcacagtctccgtcg
cctaggaagagtcctcggtctgccaaccacccgccacctgcaatcagtccccttcgccct
cagttcgctacttcgactgctggatcgccaaacgggacgccctcccgccccggtagcgcc
atgcggaacgtatcatacggccggccaccgtctcgctctcaaactcctgcacttcgccgc
aaagcctccatgaactcgatccaggtcgcccacaacagcaatggccatggacttcgtcga
tccagttcagtcaacctcacaccgtccgccgccaagaagtcacctttaaacgacatgtcc
cctgatacgtccgagttcaaagtgccgcccaccccgcaatccatcgcgagtgaccacttc
aaggccgagcttgagattcatcacggacatgatccaaaattgtcggccgagaccattgtt
attctgaacgatgcatgctatggacatcgctattctcgaccccggacatccaaggcaagc
ttgagcaccatcgtcgaacgacccgagaggatcaaggccagcgtcttgggagtgtcggcc
gcctatgtacgtctgggcgagcgacaccaagacggttcgttcccgattcatccggatcag
catcccaggaacctcccttcggtaccttttctcatacaaaaaacgactcgacgactggcc
atcacatctccgacagtaaccaacgtacatggcacgaaatggatggaggaactcaagatc
atgtgcgataccgctgaagcgaagctggcgacgaatggcaaagaacttcaacgcccggat
atggatcgtggacctaatgcggaagagcccccaaagtttcatgaaggtgacctctatctc
tgtgcagaatcactagatgctatggaaggagctctcggcggtgtctgtgaggccgtcgat
gcggtgtttaagcctgagggtccgaaaagggcttttgtagctattcgcccgcctggccat
cactgctccgcctcgtatccctcgggcttttgttgggtcaacaacgttcatgtgggcatt
atgcacgcaattttgagccatggcttgacccatgccgccattatcgactttgacctacac
cacggcgacggctcccagcaaattgcttggcagcacaactcaagaggcgtaaaggctgca
aagaacgcagcgatgtggaagaagacctcgattgggtactttagtcttcacgatatcaac
tcgtatccttgcgagaccggcgacgacgaaaaagttatgaacgcgagtgtatgcatcgac
aatgctcatggacagaatgtgtggaatgtgcacctacagccctgggagacagaagaggat
ttctgggcactctacgagtccaagtacaccgtcttgcttgagaaggcgcgcagctacctt
gtcacagaggcggagcgcttgcgagcagcaggccaaaacgcaaaggcagccatcttcctt
tctgctggtttcgatgccagcgaatgggagggcgctggaatgcagagacacgaagtcaac
gtccccacagagttctatgctcgattgacccgagatgtagtacgtattgcagcagaagtg
gacacggctgtagagggccgaatcatcagcgtactggagggaggatatagtgatcgggcg
ctttgctctggcatcatgagtcacgtttgcggccttgctggagctggttctactggaaat
ggcaaagctcatgatcagtacaacccttcgtggtggtctgctgccgcgcttgaacatctg
gaaaccacactgttgactcccccacccgaaccaccaaagccccctcggaacgttgcgact
cctacctactgttcacctacacaggcctctacggcacggtctgtagcgccacggagaacc
aacaggccgatgtcaccaatgccgtcgagaataccgatgccccctgctccagaggttccg
tgggctattgctgcttgcgaactgagcaagcttcttattccgcgcgaccgccaaacggat
agctgtactcacacagatcttaatgctgaggccaccaaggctcgccgggagcgccagtta
gcccaggcaaatacttcggcgtccgatgctggcactgcaaactcatcggatcggccctct
acaaggatggccttaagggagcgtaaagccaagcaagcagtgcctatcaaggaggaggac
acagacgaagaccgagtgaacgctgtgtccgcaggaaagactggtgtgccccgaggaggc
gctcgtgctacacgtagtcgacgccttagtgctgcttcgaccatcgtcccagacagcctt
gactcgtctcctccaagccacagatactcagccacaaatgcggaagatgacggaagaccg
gaaacatccatgagcatcaggcccgagtcttcaatgagtgtgagaccgcaggggaaccct
cttgtggtcaataaaacgcgggggccagcaaagaataaggatgctctgcaagcaccgagg
acacagaggaagatttcaacttcaaccattgaatcagcaaggagctccaacgcatcccta
gtatcaccagcttcggcttcccttaacgatcagccatcaactggtagcaatggcgacggc
gtagatacagtgactggcgggatgaagaaggtgaagattactcttatcacacaagcccag
aaagaggctcgcgagcgggagcgtgctgcgaacgaaaacgccggtgcgatttctgtcgtt
acatccaacctacaggaaaacaaacttcgtcaacaacagcctacgcagacacccgttgcc
acagtccaatctcccaccgaaagcaacaccacctctcccgcgccatccacgcagttctac
actcccaactcacaaggccggaactcattttcctcctccgaagacatggacgccacggac
aagtacccggagcttttcgggcaccatcaccttcaagacggggacggtgacatcgacatg
gaagacttcgaaatacccgctcttgcatccacgcccatgcctagtcgtacttcattccct
ctgcctttgaggcctcttcaacagtcttccactcccttggaaaacttcatacagtaccag
cctcctgctggcaagcatcatgcctcggtaccagcacagacaccaactagtcccggacat
gctatgaacagaaaggacgtgcccgtgtttactgccacctcagccattcccttttcgcct
cagaagacggagcaattgcagcagtctccggcgccgtctacgcctgcttcattgccaagt
gtgatctttgctggacagaagcaggaagagaaggaggaggctgtggagacgccagagagg
aattga

DBGET integrated database retrieval system