KEGG   Nicotiana tomentosiformis: 104120999Help
Entry
104120999         CDS       T05025                                 

Definition
(RefSeq) histone deacetylase 2 isoform X1
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
nto  Nicotiana tomentosiformis
Brite
Enzymes [BR:nto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104120999
Chromosome [BR:nto03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     104120999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MSTASSSKTDDAEALRRHRILSSKLYLDVPPSKVPLIYSSSYDISFLGIEKLHPFDASKW
GRICRFLSKNGIVDQKHIVEPVEATKDDLLVVHSESYLKSLNSSLNVSKIVEVPPAAMLP
NCLVQQKVLRPFRKQVGGTIVAAKLAKERGWAINVGGGFHHCSSERGGGFCVYADISLCI
HFAFVHLNISRVMIIDLDAHQGNGHEMDFSEDRRVFILDMYNPGIYPLDFEARRYIDLGI
EVQSGTATDEYLTKLDHALEVAEKKFDPDFVVYNAGTDILDGDPLGRLKISPDGIASRDE
KVFRFARERNIPLIMLTSGGYMKSSARVIADSIINLSEKSLIDMKSLPAGKA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcatcttcatccaaaaccgacgacgccgaagctctacgtcggcatcgtatt
ctctctagcaagctgtatttggatgtgcctccttctaaggttccgttgatatactcgtca
tcctatgacatttcttttctcggtattgagaaactgcatccatttgacgcttcaaaatgg
ggtcgaatctgccggtttctctctaagaacggtatcgtggatcaaaagcatatagttgag
cctgtggaggcaacaaaagatgatctgctagtggtgcattcagaatcatacttgaaaagt
ttgaatagcagcttgaatgtctccaagattgttgaggtccctcctgctgcaatgcttccc
aattgccttgtgcagcagaaagtgcttcgccctttccgcaagcaggtgggaggaacaatc
gtggctgcaaagcttgcaaaagaacgaggatgggctattaatgttggtggtggatttcat
cattgttcatcagagaggggaggcggtttttgtgtttatgctgatatatctctttgtata
cattttgcatttgtgcatttaaatatctcaagagtcatgataatcgaccttgatgcacac
caaggaaatggccatgaaatggacttctccgaggacagaagagtctttatccttgatatg
tacaatcctggaatttatccacttgattttgaagccaggcggtacattgatctaggaatc
gaagttcagagtgggactgcaacagatgaatacttgactaagctagatcatgcacttgag
gttgcagagaagaaatttgatcccgattttgttgtctataatgctggcactgatattttg
gatggggatccacttggcaggttgaagatcagtcctgatggcattgctagtagggacgaa
aaggttttcaggtttgctagagagagaaacatccccctcatcatgctcacatcaggcggt
tacatgaaatccagtgccagagttattgctgattcaatcataaatctctctgagaaatcc
cttatagacatgaaaagtttaccagctggaaaagcatag

DBGET integrated database retrieval system