KEGG   Nocardia terpenica: CRH09_25835Help
Entry
CRH09_25835       CDS       T05168                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ntp  Nocardia terpenica
Pathway
ntp00250  Alanine, aspartate and glutamate metabolism
ntp00410  beta-Alanine metabolism
ntp00640  Propanoate metabolism
ntp00650  Butanoate metabolism
ntp01100  Metabolic pathways
ntp01120  Microbial metabolism in diverse environments
Module
ntp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ntp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRH09_25835
   00650 Butanoate metabolism
    CRH09_25835
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CRH09_25835
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRH09_25835
Enzymes [BR:ntp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CRH09_25835
Amino acid related enzymes [BR:ntp01007]
 Aminotransferase (transaminase)
  Class III
   CRH09_25835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATL69085
UniProt: A0A291RP26
LinkDB All DBs
Position
5842181..5843422
Genome map
AA seq 413 aa AA seqDB search
MTALSPVLKQATPITVDHGEGCYLHATDGRRYLDFTAGIGVTSTGHCHPRVVEAARAQVG
SLIHGQYTTVMHRPLLALTERLGEVLPTGLDSLFFSNSGSEAIEAALRLARQATGRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGFSPLMAGVHVAPFPTAYRYGWSEEQATDFALREL
DYLFATQSSPAETAALFVEPVLGEGGYIPGNTRFFQGLRERADRHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDVITIAKGLASGFPLSGIAASKELMAQAWPGSQGGTYGGNAVACAA
ALATIEVIESEGLVDNAAKRGQQLLTGVRDRATAAIGDVRGLGLMVGAEFVSATGEPDTA
TAAAAQRLAVDKGLLLLTCGAHMNVVRMIPPLIVSAAQIDDALEIWSAVLAEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcactttcccccgttctcaagcaggccacaccgatcaccgtcgaccacggtgaa
gggtgctatctccacgccaccgacggccgccgatacctcgacttcaccgccgggatcggc
gtgaccagtaccggccactgtcacccgcgggtggtcgaggcggcccgcgcccaggtcggc
agcctgatccacggccagtacacgacggtcatgcaccggccgctgctggcgttgaccgag
cggctgggcgaggtgctgcccaccgggctggactcgctgttcttctccaattccggcagc
gaggcgatcgaggcggcgctgcgcctggcgcggcaggccaccggacggccgaatgtcatt
gtgttccaggggggtttccacggccgcacggtggccgcggccaccatgaccacctccggg
acgcggttctcggccgggttcagtccgctcatggcgggggtgcacgtcgcgccgttcccg
accgcgtaccgctacggctggagcgaggagcaggccaccgatttcgcgctgcgcgagctg
gattatctgttcgcgacgcagagttcgcccgcggagaccgcggccttgttcgtcgagccg
gtgctcggcgagggcggctacattccgggcaatacgcggttcttccaggggctgcgcgag
cgggcggaccggcacggcatcctgctcgtgttcgacgagatccagaccgggttcgggcgg
accggaaagttcttcgggcaccagcacttcgacgtgcggccggatgtcatcaccatcgcc
aagggcctggcgagcgggttcccgctgtcgggcatcgcggcgtccaaggagctgatggcc
caggcgtggccgggctcgcagggcggcacctacggcggcaatgcggtcgcctgcgcggcc
gcgctcgctaccatcgaggtcatcgaatccgaagggctggtggacaatgcggcaaagcgc
gggcagcaactgctgaccggcgtccgcgaccgcgccaccgcggccatcggcgacgtgcgc
ggcctgggtctcatggtgggcgccgaattcgtctcggccaccggcgaacccgacaccgcc
accgcggccgccgcccagcggctcgcggtcgacaaggggctgctgctgctcacctgcggc
gcccacatgaatgtcgtccgaatgatcccgccgctcatcgtgtccgccgcccagatcgac
gacgcgctcgagatctggtccgccgttctcgccgaattgtga

DBGET integrated database retrieval system