KEGG   Nocardia terpenica: CRH09_34070Help
Entry
CRH09_34070       CDS       T05168                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ntp  Nocardia terpenica
Brite
Enzymes [BR:ntp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     CRH09_34070
Lipid biosynthesis proteins [BR:ntp01004]
 Acyl-CoA synthetase
  Unknown
   CRH09_34070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ATL70463
UniProt: A0A291RSJ8
LinkDB All DBs
Position
complement(7678104..7679828)
Genome map
AA seq 574 aa AA seqDB search
MFFEEALPPEGATASTFIQVLAENLGYCDSGYTFIHEDGREHLVSWSELSREALRRGRRL
LGSGLRKGERIALILPDEQEFVLTFLGAVSVGVIPVPMYPPMGSSKFEAYCRDAVHILRV
AGARALLMPRSLADLLDPLLHAVEGLRAVVSEEFFAEPPVGSAPRPEAILPQDVMFLQFT
SGSTAAPKGVRVTHASVLANCAAITSALRLERGRDRGVSWLPVYHDMGLVGFVLAPLIAR
CPVTFLPTLRFALSPRLWLETVSRHRATVTFAPNFGLALALRHTSAEELQRLDLSCLRVV
GCGAEPNHPETLRSFAAHFAAAGLRPGAVVPCYGMAEATLAISFGEIGVPLALDVIQKEP
YHASGLARPASEAEVPGAQMVFVACGRPIAGHRILIVDDEGNPLPERHIGEVAFQGPSVA
AGYHGDAEATRRSFTAHGLRTGDCGYLAEGILYVTSRKKDLLIINGRNHDPQTVEWAAAE
VPGLRKGNVVAFTRPGRTTEEVVIVAELRGGNAATVARQVRGHIQTKLSLPVAEILLLVP
GELPKTSSGKVKRSKTRQQYLEGALHCGALSQTS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcgaagaagcgttgcctccggagggcgcgacggcctcgaccttcatccaggtc
cttgccgagaacctcggctattgcgacagcggctataccttcatccacgaggacgggcgc
gagcacctcgtgagctggtcggagctgtcgcgggaggcgctgcgccgagggcgccggctg
ctcgggagcggcctgcgcaagggagagcgcatcgcgctcatcctccccgatgagcaggag
ttcgttctcaccttcctgggcgcggtctcggtgggcgtcatcccggtccccatgtacccg
cccatgggctcgagcaagttcgaggcgtactgccgggacgcggtccacatcctgcgcgtg
gcgggggcccgcgcgctcttgatgccccggagcctggcggacctgctggacccgctcctg
cacgcggtcgagggcctgcgggccgtcgtctcggaggagttcttcgccgagcccccggtg
gggagtgcgccccggcccgaggcgatcctcccgcaggacgtgatgttcttgcagttcacc
tcggggagcacggcggcccccaagggagtgcgggtcacccacgccagcgtgctcgccaac
tgcgcggccatcacgagcgcccttcggctcgagcgcgggcgagaccgaggtgtgagctgg
ttgcccgtgtaccacgacatggggctggtcggtttcgtgctggcgccgctgatcgcgcgc
tgcccggtgaccttcctcccgacgctgcgcttcgcgctctcaccgaggctctggctggaa
acggtgagccgccaccgcgcgaccgtgacgttcgcgcccaacttcggcctggcgttggcc
ctccggcacacctcggcggaggaactccagcggctggatctgtcctgcctgagggtcgtg
ggctgcggcgccgagcccaaccaccccgagacgctgcgctccttcgcggcgcacttcgcc
gcggcggggctgcggccgggggcagtggtgccgtgttatggcatggcggaggcgacgctc
gcgatctcgttcggcgagatcggagttccgctcgccctggatgtcatccagaaggagccc
taccacgcgagcggcctcgcgcggcccgcctcggaggcggaggtccccggagcgcagatg
gtgttcgtggcctgcggacgccccatcgcgggtcaccgaatcctcatcgtggacgatgag
gggaatccgctcccggagcggcacatcggcgaggtggccttccaggggccgagcgtggct
gcgggctaccacggtgacgcggaggcgacccggcggagcttcacggctcacggcctgcgc
acgggggattgtggatacctggccgaaggcatcctctacgtgacgagccgcaagaaggac
ctgctgatcatcaatgggcgcaatcacgacccccagacggtggagtgggccgcagccgag
gtgcccggcctgcgcaagggcaacgtcgtggccttcacccggccgggccggactaccgag
gaggtggtgattgtcgccgaactccgcggggggaacgccgccacggtggcgcggcaggtc
cgcgggcacatccagacgaagctgtccctgcccgtggcggagatcctcctgctggtgccg
ggggagctgcccaagacctccagcggcaaggtgaagcggagcaagacacggcagcaatat
ctcgagggagctctccactgtggagcgctctctcagacgagctga

DBGET integrated database retrieval system