KEGG   Novibacillus thermophilus: B0W44_00670Help
Entry
B0W44_00670       CDS       T04694                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ntr  Novibacillus thermophilus
Brite
Translation factors [BR:ntr03012]
 Eukaryotic Type
  Elongation factors
   B0W44_00670
 Prokaryotic Type
   B0W44_00670
Mitochondrial biogenesis [BR:ntr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B0W44_00670
Exosome [BR:ntr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B0W44_00670
  Exosomal proteins of breast cancer cells
   B0W44_00670
  Exosomal proteins of colorectal cancer cells
   B0W44_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
126042..127232
Genome map
AA seq 396 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLASKGSGEARGYDQIDNAPEERERG
ITIATSHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSQQVGVSHIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIRGSALKALE
DPNGEWAKSIHELMEQVDSYIPTPERAVDKDFLMPVEDVFSITGRGTVATGRVERGTIKV
GDEVEIVGIKPETNKTVVTGVEMFRKLLDQAEAGDNIGALLRGVDRDEVERGQVLAKPGS
VNPHTKFSGEVYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGVITLPEGTEMVMPGDNVT
MDVELIAPIAIEDGTRFAIREGGRTVGAGVVTKINE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaagtttgagcgttcaaaaccacacgttaacgttggcacgatcggtcac
gttgaccacggaaaaacgacgctgaccgctgcgattacgacagtgctggcttcaaaggga
agcggtgaagcccgcggctacgatcagatcgacaacgctccggaagagcgcgaacgcggc
attaccattgcgacgtctcacgtggagtacgaaacagaaaaccgtcactacgcccacgta
gactgcccgggtcacgctgactacgtcaaaaacatgatcaccggtgcagcccaaatggac
ggcgccatccttgtcgtatccgctgcagacggtccgatgccgcaaacgcgggaacacatc
ttgttgtcccaacaagtcggcgtctcccacatcgtcgtgttcttgaacaagtgcgacatg
gttgacgacgaagagctgttggaactcgtcgaaatggaagtgcgcgacctgctctcggag
tacgacttccccggcgacgacattccagtcattcgcggttcggcactgaaagctttagaa
gacccgaacggggaatgggctaaaagcattcacgaattaatggagcaagtcgactcctac
attccgacaccggaacgcgccgtagacaaagacttcctcatgcccgtggaagacgtgttc
tccattaccggccgcggtaccgttgcaaccggccgtgttgaacggggaacgatcaaagtg
ggcgacgaagttgaaatcgtcggaattaaacccgaaacgaacaaaacagtcgtaaccggt
gtggaaatgttccgcaaactgttggatcaagcagaagccggtgacaacatcggggctctt
ctgcgcggtgtggaccgggatgaagtcgaacgcggtcaagtactggcaaaacctggttcc
gtgaatccccacacgaaattttccggcgaagtgtacattttgacgaaggaagaaggtggg
cgtcacaccccgttctttaacggataccgtccccaattctacttccgcacaacagacgtc
acaggtgtcatcactctgcctgaggggacggaaatggtgatgcctggtgacaacgtcacg
atggatgtcgagctgatcgctccgatcgccatcgaagacggaacgcgcttcgctattcgt
gaaggtgggcgcactgtcggtgccggcgttgtcacaaaaattaacgagtag

DBGET integrated database retrieval system