KEGG   Nitrosomonas ureae: ATY38_04155Help
Entry
ATY38_04155       CDS       T04188                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nur  Nitrosomonas ureae
Brite
Enzymes [BR:nur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     ATY38_04155
Lipid biosynthesis proteins [BR:nur01004]
 Acyl-CoA synthetase
  Unknown
   ATY38_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(869164..870987)
Genome map
AA seq 607 aa AA seqDB search
MSSTIIKLNAPLTQAFDFQPSSELHLTPTPTLNTLIQQLAGFDTLTSALEYAAKGVTGYN
FYDAKGNVRSVLPYKILRQNARILAKRLFGFDLPRGSRVAIIADTSPEFVELFFACRYAG
LVPFAMPIPVNLGSHAIYVQQLRGMLESSQASIALANIDYINFLDEAVIGATSIRWTGTP
GKLNELPIHDVELQPNHPDETAYLQFTSGSTRTPRGVVITERALMCNLQGIVRNGLEIRS
DDRSASWLPFYHDMGLVGLVLAPMVTQISVDYLATRDFAIRPLQWLRLISRNRCTVAFSQ
PFGLKLCTLRVRESDLKELDLSCWRAAGIGAEMIRPETLRNFAEKFSSAGFDENAFLPCY
GLAESTLAVTFSKINTGCNSLQVDSKTLIDKKMAVRLQADGRKQNEFVNCGRPLPGHIVK
IIGEDGHQLSEMMVGSVLVQGDSVMTGYYNNPEETNKALKPGNWLDTGDIGFLFEGDLFI
TGRRTDVIIVNGRNIRAQDIEELAEQQPEVRSREASAFGVNDEDGTTTIVLVIECRLTSP
TERQSLTTRLQQLVYMAFGVNCVVELVPPHTLPRTSSGKLSRFAARQGYIQRTQLVDQLS
FVESGDR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcgacaataatcaagttgaacgctccgctaacgcaagcgtttgattttcagcct
tcaagcgaattgcatctaacaccgacaccgacactcaatacgctaattcagcagttagct
ggctttgatacgctaacaagtgctttagaatatgcagcgaagggagtaacggggtataac
ttttatgacgcaaagggaaatgttcgttcagttctgccatacaagatacttaggcagaat
gctcgtattttggctaagcgtttgttcggttttgatttgccccggggtagccgggtagcg
atcatcgctgatacctctccggaatttgttgagttgttttttgcatgccgctatgctggg
ttagttccatttgcaatgccgattccggttaatctcggaagccatgcaatatatgttcag
caattgaggggtatgcttgaaagtagtcaagcgagtattgcactagctaatattgattac
attaattttcttgatgaggcggtaataggtgcaaccagcattcgctggacgggaacaccg
ggaaaattaaatgagcttcctatacatgatgtagaactgcagcctaatcatccagatgaa
actgcgtatttgcaatttacatcaggtagtacgcgcaccccacgtggtgtagttataacg
gaacgagccttgatgtgtaatttacagggtatcgtgcgtaacggtttggaaataagatct
gatgatcgttctgcatcgtggttgcctttttatcatgatatggggttggttgggctcgtt
ctggctccgatggttacacagatttcagtagattatttagcaactcgggattttgcaatt
cgtccattgcagtggctgcggctaattagcaggaatcgctgtacggttgcattcagccaa
ccatttggccttaagctatgtacacttcgtgtgcgagaatctgatctaaaagaattggat
ttgagttgttggcgagcagctggtatcggcgcagaaatgattcgtcccgaaactttaaga
aacttcgctgagaaattttcatcagccggctttgatgagaatgcttttttgccatgttat
ggacttgcagaatcaacacttgctgttacattttcaaaaatcaatacaggatgtaatagt
ctgcaagtagatagtaagaccctgattgataaaaaaatggcagtgagattgcaagctgat
ggtcgaaaacaaaatgaatttgtaaattgcgggcgtccattgcccgggcatatcgttaaa
ataattggcgaagatggtcatcaattatctgagatgatggttggaagcgtactggtgcag
ggcgatagcgtaatgactggttattataataacccagaagagacgaacaaggcacttaag
cctggaaattggctcgatactggcgatattggttttctgtttgaaggtgatttgtttata
accggacgtcgtaccgatgtgattatagttaatggtcgcaatattcgagcgcaagatatc
gaagagctagccgaacagcaaccggaagtcaggtcgcgtgaggcatctgcttttggagtt
aatgatgaagatggtaccacgactattgtactagtgattgaatgcagacttacctctcca
acagaacgtcaatcactgactactagattgcagcagcttgtttatatggcatttggagtc
aattgtgttgttgagcttgtaccgccgcataccttgccaaggacctcatctggtaagctt
tcgcgttttgcggctagacagggatatattcagagaactcaattagttgatcaattatct
tttgtagagtcaggcgacagataa

DBGET integrated database retrieval system