KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g190941Help
Entry
NEMVE_v1g190941   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     NEMVE_v1g190941
Peptidases [BR:nve01002]
 Metallo Peptidases
  Family M2
   NEMVE_v1g190941
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g190941
CD molecules [BR:nve04090]
 Proteins
  NEMVE_v1g190941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 1096 aa AA seqDB search
MQYSQRESEMTEIYSSAKVTNPAIGTNLSLNPQLTELMANSRNSPELLAAWRDWRQVTGP
KMRPLFKDCVTLANQGAKDNGFQNMYEYQTHLYELPNLEEYIDGIWQELKVLYLELHAYV
RQRLSEQYPHVLSSQAIPAHLLGNMWAQNWVNIYPLVEPYSGKPSLDVTKNLRQQNYTAV
KMVQLAEAFFRSIGFEKLPGSFYSKSMFEKPEDREVLCHAAALDFFEKNSKGEKDVRIKQ
CTEITHQDLIITHHEMGHIYYFLKYWDQPYIYRDGANPAFHEALGDTIALSVDTPRHLVK
VKLLDEYMEDKEAEINALMKMALSKIAFLPFGYLLEKWRWQVYTGEIDSSEYNKKWWELR
VKHQGVRPPISRDETTFDPGSKFHIAANARYIQYFLSRILQFQLHKTVCDIAGINEPLHK
CSIYNSTKAGQKLSAMLEMGRSKPWRDTLEAFTGSRDMSVNPLKEYFHPLYQWLVEQRCQ
NKYKIGWPGTEGPDYDPCEPPTFLPPVEPTSSHHTALPSAHASKTAGLSTHVILGICFMA
SSFLEEARKEAKKFDLTKLSNDTRRQIKMVTETASSSDKDVQKTLNDVEGKMDQIYGSGK
VIDTDGSKLSLDPHLYKILSNSRDYERLKFVWKGWRDATGPELRPLYKQFVELANKGAKE
NGWADNGEWWRSWYEIDNLESSVEALYEDLRPLYEELHAYVRYKLSKKYSQVKPTGPIPA
HVFGNMWAQSWVNIYDIIEPYENQPSLDVTKTMVAQNYTQLRMVQLAESFFTSIGLKALP
MSFYEKSMIVKPEGREVQCHASAWDFKINRDVRIKQCTTITHNYLVTTHHELGHIQYYLQ
YWDQPFEYRTGANPGFHEAVGDTLSLSVDTPTHLKLIGLLDAVSNDSKSDINALMKMALR
KVAFLPFGFLIDQWRWKVFSGDITSDNYNREWWKLRTKYQGIKPPVCRTENDFDPGAKYH
IPGNTPYIRYFVSFVLQFQFHKAACEAAGHQGPLHKCSIYNSTEAGKKLGDMLSLGKSKP
WPLALEQMTGTRKMDVSSLKEYFKPLSDWLKSQRQEYKYTIGWSNDGAYDECPSSAGAML
VPFIGSILAALLIALY
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgcagtactctcaaagggagtcagaaatgacagagatttatagctcggcgaaagtaact
aaccctgctatcggtacaaatctttcgctcaatcctcaattgaccgaattgatggcgaat
tcccgcaactcgcctgagcttcttgccgcgtggcgtgactggagacaggtcacgggacct
aaaatgcgacctctgttcaaagattgcgtgacacttgcaaaccaaggggcaaaggacaat
ggcttccaaaacatgtacgaataccagacacatctatacgagctacccaacttggaggag
tatattgatggcatttggcaagagttaaaagtgctttacttagagttacatgcgtacgtc
cggcaaagactttcggagcagtatccccacgtgctttcctcccaggcaatcccagcacat
ctccttggcaacatgtgggcgcagaactgggtcaacatctaccctttagtagaaccatac
tcaggaaaacccagcctcgatgtgaccaaaaacctcagacaacaaaactacaccgcagtt
aagatggtgcagctagccgaagcgttttttaggtcgattggttttgagaagttgccgggt
agtttctatagtaagtcgatgtttgagaagccagaggatcgagaggttttatgccacgca
gctgctttggatttcttcgagaaaaattcgaaaggagaaaaagacgtaagaatcaagcag
tgtaccgagattactcaccaagacctgatcatcacgcatcacgagatggggcacatctac
tacttcctcaagtactgggaccagccgtacatctaccgtgacggcgccaacccggccttc
catgaagccctgggggacaccatagccctgtccgtagacacgccccgtcatctagtcaaa
gtcaaacttctcgacgagtacatggaagacaaggaggctgagataaacgcgcttatgaag
atggctctcagtaagatcgcgtttcttccctttggatatctactggagaagtggagatgg
caggtgtacacgggcgagatcgactcatctgagtacaacaaaaaatggtgggagctacgc
gtcaaacatcagggtgtcaggccgcccatcagtcgggacgagacgacttttgaccccggc
tccaaattccacatcgcggcgaatgcgcgatacatacagtatttcttgagcaggattcta
cagtttcagctccacaagaccgtttgtgatatcgcgggcatcaacgagccattgcacaag
tgttctatctacaactccacaaaggccggacaaaaactgagtgctatgctagagatgggg
cgaagcaaaccctggcgggataccctcgaggccttcacgggatcacgggatatgagcgtg
aaccctctcaaggaatactttcatcctctttatcaatggctcgtcgagcagcgctgtcag
aacaaatacaaaataggatggcctgggaccgagggtccggattacgacccctgcgagccc
ccaacattcctgccgcctgtggaacccacttcttcgcatcacaccgcacttccaagtgcg
catgcctcaaagaccgctggacttagtactcatgtgattcttggaatttgcttcatggcg
tcctcgtttttagaagaggcccggaaagaagcgaagaaattcgacttaaccaaactttca
aatgatacccggcggcaaattaagatggtcactgagacagcgagttcttccgacaaggac
gtccagaaaacattgaacgacgtggagggaaaaatggaccagatttatggctcggggaaa
gtgatcgataccgacggcagcaagctttctcttgaccctcacttgtacaagattcttagc
aactctcgagactacgagcgactcaagtttgtatggaaaggctggagagacgccacgggc
cccgagctgcgacccctttacaagcaatttgtagagctcgccaacaaaggggctaaggag
aacggatgggcagataatggggaatggtggcggtcatggtacgagatagacaacttagaa
agcagtgtggaagccttgtacgaagacctgagaccgctttacgaagagctccacgcgtac
gtgaggtataagctgagtaagaagtattcgcaggtcaaaccaaccggccccattcctgcg
catgtgtttggaaacatgtgggcacaaagctgggtgaatatctacgatatcattgagccg
tatgagaaccagcctagcctggacgtgacgaagactatggtagcgcagaattacacgcag
ctccgcatggtccagctcgcagagtctttttttacatccatcgggttaaaggcgcttccc
atgtctttctatgagaagtcgatgatcgtgaaacccgagggacgggaagttcagtgccac
gcctccgcctgggacttcaagatcaaccgtgatgtcaggatcaagcaatgcacgaccatc
acgcacaactacctggtcacaacacaccacgagcttggtcacattcagtattacctgcag
tactgggaccagccattcgagtaccggacgggcgccaacccgggcttccacgaggcggta
ggcgacaccctctccctttccgtggacacgcctacacacctcaagctgattggtctgctg
gacgctgtcagcaatgattcgaaatcggatatcaacgccctgatgaaaatggctctacga
aaggtcgccttcttgccctttggtttcttgattgatcaatggcgctggaaggtcttcagc
ggagacatcacatccgacaactataaccgtgagtggtggaagctccgtacaaagtaccag
ggcatcaagcctccagtctgccgcacggagaacgatttcgaccctggcgccaagtaccac
attcctggaaacaccccgtacatcaggtactttgtgagcttcgtgctgcaattccagttt
cacaaggcggcatgcgaagccgctggtcaccaaggcccactccataagtgctccatctac
aactctaccgaggccggcaagaaactaggtgacatgctctcactcggtaaaagtaagcct
tggccgctcgcccttgagcagatgactgggacgagaaagatggacgtcagctcgctcaaa
gaatacttcaagccgctctctgattggttgaaaagccagcgccaggaatacaagtacact
attggctggtctaatgatggcgcgtacgacgaatgcccctccagtgccggagccatgttg
gttccctttattggatctatactggcggcacttctaattgctttgtactaa

DBGET integrated database retrieval system