KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g221517Help
Entry
NEMVE_v1g221517   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 198 aa AA seqDB search
MFLENTVNQSEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPSVDTRYDEEM
VVSHDANEIRSTPVPLAGNIRILAQGCDVVGIDEAQFFDDEIVSVCNDLANSGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLANYSFRKTENDKLVMLGETDEYEP
LSRAAFYRALKESKEAKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagaaaataccgtaaatcaatctgaacaatttggctggatagaagtaatctgt
ggttcaatgttttctggaaaaacagaagaactaattcgacgcttaaaaagagcacaattt
gcaaaacagaaagtcgagattttcaaaccatcggtagatacacgctatgatgaagaaatg
gtggtctcgcacgatgccaatgaaattcgttccacacctgttcctttggcgggtaatatt
cgcattttagcacaaggttgcgatgttgttggaatagatgaagcacaattttttgatgat
gaaattgtttcggtgtgcaatgatttggcaaatagtggtattcgcgttattgttgcgggg
ctcgacatggattttaagggcaacccttttggccccatgccaaatttaatggccaccgca
gaatatgtaactaaagtacacgctgtttgtactcgcactggaaatttggctaattatagt
ttccgtaaaacggaaaatgataaattggtaatgctaggggaaacagacgaatacgaacct
ttaagtcgagcagccttttatagagcgctgaaggaaagcaaagaagcaaaaaaataa

DBGET integrated database retrieval system