KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g234825Help
Entry
NEMVE_v1g234825   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NEMVE_v1g234825
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NEMVE_v1g234825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5513890
NCBI-ProteinID: XP_001634104
JGI: 234825
UniProt: A7S2P3
LinkDB All DBs
AA seq 154 aa AA seqDB search
MVIRGVCCLVGDNEVKGVIHFTQQAPDGPCTLRGRITGLTEGKHGFHIHEFGDNTNGCTS
AGAHYNPHGKMHGAPEDKDRHLGDLGNIEADANGIADVSITDCLVSLTGQCSIIGRSLVV
HEGMDDLGAGGHELSLTTGNAGGRVACGVIGIAL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttataaggggtgtttgttgcctggtaggggataatgaagttaaaggagtcatccat
tttacccaacaggctcctgatggcccttgtactctcagaggcaggataaccggcctaaca
gaagggaaacacggctttcatatacatgagtttggggacaacacaaatggttgcacaagt
gcaggagctcattacaacccacatggaaaaatgcatggggctccagaggacaaagacagg
catcttggagatcttggtaacatagaggctgatgccaatggtattgctgatgtcagtatt
acagattgcttggtcagcttaactggacagtgctctatcattggacgatcgcttgttgtc
catgagggcatggatgaccttggggctggaggtcatgagctaagcttgacgacaggaaat
gctggtggacgggtcgcctgtggtgtcattggaatcgccctgtag

DBGET integrated database retrieval system