KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g83876Help
Entry
NEMVE_v1g83876    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NEMVE_v1g83876
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    NEMVE_v1g83876
   00982 Drug metabolism - cytochrome P450
    NEMVE_v1g83876
Enzymes [BR:nve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NEMVE_v1g83876
Transporters [BR:nve02000]
 Other Transporters
  Pores ion channels [TC:1]
   NEMVE_v1g83876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 236 aa AA seqDB search
MDGSLPKLYNAWFCPFAQRAWIAMLAKKAEFEYIEQNPYNKTPEWLAINPNGLVPVIVHN
GNAVYESSICIEFIDEAFSTPVTILPKDPYKRAHGRMWGDFVSKKLVPHFYTMLLKQDKE
DQEEAKTKYLEGLRTFTNEMDPEGPFFQGKHLGYVDIMWAPFAARMHILEHYRGFSVPQT
DEFKRYHHWWDIIKRHSAVANTLQDEEKMLQVYQRYAFNTTRSQVSEAIRKGTALP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggatggctctcttcctaagctgtacaatgcatggttttgtccttttgctcagagggcc
tggattgccatgctggctaagaaagctgaatttgaatacatcgagcagaacccctacaac
aagaccccagaatggctggcaataaatccaaatgggctagtccctgttattgtacacaat
ggtaacgctgtgtatgaaagctctatctgtattgaattcattgatgaagcattctcaact
cctgttacaatcttgccaaaggacccgtataagcgagctcacggtagaatgtggggtgat
ttcgtaagcaagaagctagttccacacttctacacaatgcttctaaagcaagataaagaa
gaccaggaagaagccaagacaaagtaccttgaaggcttgaggactttcaccaatgaaatg
gacccggaaggaccattcttccagggtaaacatttggggtatgttgatattatgtgggct
ccttttgcagctcgaatgcatatcctggagcactaccgcgggtttagtgtccctcagacg
gatgagtttaaaaggtaccatcattggtgggatattattaaacggcattctgctgttgcc
aacaccctccaggatgaagaaaagatgttgcaggtgtaccagagatatgcattcaatact
acaagatcccaggtcagcgaggcaatacgcaagggaacagcactgccgtaa

DBGET integrated database retrieval system