KEGG   Nasonia vitripennis (jewel wasp): 100114423Help
Entry
100114423         CDS       T01081                                 

Gene name
GstD1
Definition
(RefSeq) glutathione S-transferase D1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00480  Glutathione metabolism
nvi00980  Metabolism of xenobiotics by cytochrome P450
nvi00982  Drug metabolism - cytochrome P450
nvi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100114423 (GstD1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100114423 (GstD1)
   00982 Drug metabolism - cytochrome P450
    100114423 (GstD1)
   00983 Drug metabolism - other enzymes
    100114423 (GstD1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100114423 (GstD1)
Transporters [BR:nvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   100114423 (GstD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 100114423
NCBI-ProteinID: NP_001165913
NASONIABASE: NV12288
UniProt: K7IT84
LinkDB All DBs
Position
5
AA seq 215 aa AA seqDB search
MPVDLYQVPGSAPCRAVRLVAAALGVELNLKHTDLMAKEHLKPEFIKMNPQHSVPTIDDN
GFYLWESRAICQYLADKYGKNDSLYPKDPKQRAVVNQRLYFDLGLYQSFADYFYPQIFGG
APADSDKLQKIHDNLKFLETFLDGQKYLAGNNLTIADLLTATTYSNFPFTDVDVSKYKNT
AKWFDRVKAEAPKYEQTNGEGLKAFKALIEQLKKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgatctgtaccaagttcccggaagcgccccttgcagggccgtccgactggtc
gccgctgccctcggcgtcgagctcaacctcaagcacaccgacctcatggccaaggagcac
ctcaagcccgaattcatcaagatgaacccacagcactccgtgcccaccatcgacgacaat
ggattctacctgtgggagagccgagccatctgccagtacttggccgataagtacggaaag
aacgactcgctctaccccaaggacccgaagcagcgcgccgtcgtcaaccagcgactgtac
ttcgacttgggcctgtaccaatcgttcgccgactacttctaccctcaaatcttcggtgga
gcaccagccgactcggacaagctccagaagatccacgacaacctgaaattcctcgagacc
ttcctcgacggccagaaatacctggctggcaacaacctgaccatcgccgacctgctcacc
gccaccacttactcaaacttcccgtttactgacgtcgacgtcagcaagtacaagaacact
gccaaatggttcgacagggttaaggctgaggcgccgaaatacgagcagaccaacggagaa
ggtctcaaggctttcaaggctctcatcgagcagctcaagaagaagtag

DBGET integrated database retrieval system